DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and eys

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_009305788.1 Gene:eys ZFINID:ZDB-GENE-130530-959 Length:2904 Species:Danio rerio

Alignment Length:194 Identity:49/195 (25%)
Similarity:66/195 (34%) Gaps:47/195 (24%)


  Fly    54 LEYLNADNRIYGPEMVSNFKTRNGQQELPVSQVC-----WRICNEDPDCIAYVHLLD---TDECH 110
            |.|....||  |...:..|..|......|  |:|     .|:|:...:|  ...|.|   |..||
Zfish   149 LNYFTIINR--GSSHLCRFGLRIAVLVKP--QLCQSSPLLRLCSGKGEC--RTTLKDDSFTCRCH 207

  Fly   111 GYSYFERTSRYLAISGELPLVADGEAVFYEKTCLRVPDACRGRLWALTKIPGSTLVYHSKKT--- 172
            .:           .||......||   .||:.||. ...|.....|.|.:|..|.:..:..|   
Zfish   208 KH-----------FSGRYCENVDG---CYEQPCLN-GGTCLSEGSAYTDLPPYTCLCPAPFTGVN 257

  Fly   173 ISTLVTRRECAERCFFETQFRCLSASFAPSYRNNRERFRGEAGP---------GQRPSPRLGRC 227
            .|.::..:.|::.|   .:..||..| :.|||  .|.|.|..|.         ...|....|||
Zfish   258 CSEIIGNQNCSKWC---KEGACLKVS-STSYR--CECFTGYTGTYCERKRLFCDSNPCRNDGRC 315

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 20/82 (24%)
PAN_AP_HGF 270..344 CDD:238532
eysXP_009305788.1 EGF_CA 305..336 CDD:238011 4/12 (33%)
EGF_CA <383..411 CDD:238011
EGF_CA 414..451 CDD:238011
EGF_CA 499..534 CDD:238011
EGF_CA 605..641 CDD:238011
EGF_CA 681..714 CDD:238011
EGF_CA 719..752 CDD:238011
EGF_CA 833..869 CDD:238011
EGF_CA 872..907 CDD:238011
EGF_CA 909..944 CDD:238011
EGF_CA 947..983 CDD:238011
EGF_CA 987..1026 CDD:238011
EGF_CA 1028..1063 CDD:238011
EGF_CA 1066..1101 CDD:238011
EGF_CA 1105..1138 CDD:238011
EGF_CA 1141..1179 CDD:238011
EGF_CA 1222..1258 CDD:238011
EGF_CA 1260..1295 CDD:238011
EGF_CA 1298..1334 CDD:238011
EGF_CA 1336..1372 CDD:238011
EGF_CA 1411..1446 CDD:238011
EGF_CA 1458..1491 CDD:238011
EGF_CA 1495..1529 CDD:238011
EGF_CA 1531..1568 CDD:238011
LamG 1645..1799 CDD:238058
LamG 1906..2077 CDD:238058
LamG 2222..2340 CDD:214598
LamG 2461..2617 CDD:238058
LamG 2721..2881 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.