DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and NOTCH4

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_004548.3 Gene:NOTCH4 HGNCID:7884 Length:2003 Species:Homo sapiens

Alignment Length:338 Identity:57/339 (17%)
Similarity:84/339 (25%) Gaps:146/339 (43%)


  Fly   104 LDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYEKTCLRVPDAC------RGRLWALTKIPG 162
            ::.|.||....|...:........|..:......|...||.....:|      .|.|...:..||
Human  1045 VEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFEGPTCSHRAPSCGFHHCHHGGLCLPSPKPG 1109

  Fly   163 STLVYHSKKTISTLVTRRECAERCFFETQFRCLSASFAPS-----------------YRNNRERF 210
                                     |..:..|||....|.                 |..:....
Human  1110 -------------------------FPPRCACLSGYGGPDCLTPPAPKGCGPPSPCLYNGSCSET 1149

  Fly   211 RGEAGPGQR-------PSPRL------------------------------GRCMLSDRDKTVQP 238
            .|..|||.|       |.||.                              |.|.|.      .|
Human  1150 TGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPGGNWDGGDCSLG------VP 1208

  Fly   239 DAFRAAPYDEE----YMENQCHERAIESDNC---------------SYELYANSSFIYAEARYLG 284
            |.::..|....    :.:.|||.:. :|:.|               :|:.|.:..|      :.|
Human  1209 DPWKGCPSHSRCWLLFRDGQCHPQC-DSEECLFDGYDCETPPACTPAYDQYCHDHF------HNG 1266

  Fly   285 LSQKECQ-AMCSHEAKFYCQGVSFYYVNQLSLSECLLHSED---------IVSLGPRSLKLRENS 339
            ..:|.|. |.|..:.                 .:|.....|         :|.|.|.:|.  :..
Human  1267 HCEKGCNTAECGWDG-----------------GDCRPEDGDPEWGPSLALLVVLSPPALD--QQL 1312

  Fly   340 VYMRRVKCLDVRV 352
            ..:.||..|.:||
Human  1313 FALARVLSLTLRV 1325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 23/154 (15%)
PAN_AP_HGF 270..344 CDD:238532 13/84 (15%)
NOTCH4NP_004548.3 EGF_CA 194..232 CDD:238011
EGF_CA 314..353 CDD:238011
EGF_CA 432..473 CDD:238011
EGF_CA 475..511 CDD:238011
EGF_CA 515..549 CDD:238011
EGF_CA 551..587 CDD:238011
EGF_CA 590..625 CDD:238011
EGF_CA <699..726 CDD:238011
EGF_CA <736..765 CDD:238011
EGF_CA 769..803 CDD:238011
EGF_CA <899..928 CDD:238011
EGF_CA 931..965 CDD:238011
EGF_CA 970..1004 CDD:238011
Notch 1165..1203 CDD:321927 4/38 (11%)
LNR 1 1170..1213 5/49 (10%)
NL 1207..1245 CDD:197463 8/39 (21%)
LNR 2 1214..1250 6/37 (16%)
Notch 1249..1285 CDD:306554 9/59 (15%)
LNR 3 1251..1294 10/66 (15%)
NODP 1380..>1420 CDD:311559
ANK 1586..1721 CDD:238125
ANK repeat 1586..1630 CDD:293786
ANK 1 1633..1665
ANK repeat 1634..1664 CDD:293786
ANK 1661..1787 CDD:238125
ANK repeat 1666..1698 CDD:293786
ANK 2 1666..1698
ANK 3 1700..1732
ANK repeat 1700..1731 CDD:293786
ANK 4 1733..1765
ANK repeat 1733..1764 CDD:293786
Ank_5 1753..>1851 CDD:330893
ANK 5 1766..1798
ANK repeat 1766..1797 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.