DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and NOTCH3

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_000426.2 Gene:NOTCH3 HGNCID:7883 Length:2321 Species:Homo sapiens

Alignment Length:572 Identity:127/573 (22%)
Similarity:188/573 (33%) Gaps:175/573 (31%)


  Fly    87 CWRICNE---DPDCIAYVHLLDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYEKTCL---- 144
            |||:.|.   ||.|.:...|.|..:||.... |||..        |:        |||.|.    
Human  1433 CWRLFNNSRCDPACSSPACLYDNFDCHAGGR-ERTCN--------PV--------YEKYCADHFA 1480

  Fly   145 --RVPDACRGR------LWALTKIPGSTLVYHSKKTISTLVTRREC--AERCFFETQFRCLSASF 199
              |....|...      |...:::|  .|:......::.|:...|.  :...|.:.    |||..
Human  1481 DGRCDQGCNTEECGWDGLDCASEVP--ALLARGVLVLTVLLPPEELLRSSADFLQR----LSAIL 1539

  Fly   200 APSYRNNRERFR----GEA--------GPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDEEYME 252
            ..|.     |||    |:|        .||..|..|          :.:.|:...:....|  ::
Human  1540 RTSL-----RFRLDAHGQAMVFPYHRPSPGSEPRAR----------RELAPEVIGSVVMLE--ID 1587

  Fly   253 NQCHERAIESDNCSYELYANSSFIYAEARYLG-LSQKECQAMCSHEAKFYCQGVSFYYVNQLSLS 316
            |:...::.|:|:|..:  |.|:     |.||| ||..|              .:.|.|..:....
Human  1588 NRLCLQSPENDHCFPD--AQSA-----ADYLGALSAVE--------------RLDFPYPLRDVRG 1631

  Fly   317 ECLLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMH--- 378
            |.|...|..|.|.|   .|...:|.:..:..|.|.|...:.|.:..:.|:.:.:.|..||.|   
Human  1632 EPLEPPEPSVPLLP---LLVAGAVLLLVILVLGVMVARRKREHSTLWFPEGFSLHKDVASGHKGR 1693

  Fly   379 ----SKDCL-----ARGSGNGSVLLTLQIGSE--------VKENRCGILRAYEMTQEYQRTFISA 426
                .:|.|     |:|......:.|..:.:|        |:|...|...|.:..|..|...::|
Human  1694 REPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMGAEEAVDCRQWTQHHLVAA 1758

  Fly   427 -LVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAIALESSLEYTEHMFP 490
             :.|.........|||            ..:.|:.|.....|...|:..|.....:||       
Human  1759 DIRVAPAMALTPPQGD------------ADADGMDVNVRGPDGFTPLMLASFCGGALE------- 1804

  Fly   491 HEGVVHYNSSTGPHP-------HPSISLQILDLSHQHETNDVQIGQNLE------LQIVAEYSPQ 542
                        |.|       ..|.|: |.||..|    ..|:|...:      |.:.|.|:..
Human  1805 ------------PMPTEEDEADDTSASI-ISDLICQ----GAQLGARTDRTGETALHLAARYARA 1852

  Fly   543 QLAEHMELQLAPLPDFRA------TSL-VAKTADNEN-FVLLIDERGCPTDA 586
            ..|:.:   |....|..|      |.| .|.|||.:. |.:||..|....||
Human  1853 DAAKRL---LDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDA 1901

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 21/110 (19%)
PAN_AP_HGF 270..344 CDD:238532 19/75 (25%)
NOTCH3NP_000426.2 EGF_CA 158..195 CDD:238011
EGF_CA 236..272 CDD:238011
EGF_CA 274..311 CDD:238011
EGF_CA 314..349 CDD:238011
EGF_CA 391..429 CDD:238011
EGF_CA 431..467 CDD:238011
EGF_CA 469..505 CDD:238011
EGF_CA 507..542 CDD:238011
EGF_CA 545..580 CDD:238011
EGF_CA 583..618 CDD:238011
EGF_CA 620..654 CDD:238011
EGF_CA 657..>686 CDD:214542
EGF_CA 810..846 CDD:238011
EGF_CA 849..884 CDD:238011
EGF_CA 887..922 CDD:238011
EGF_CA 929..960 CDD:238011
EGF_CA 1085..1120 CDD:238011
EGF_CA 1122..1158 CDD:238011
EGF_CA 1171..1203 CDD:238011
Notch 1384..1418 CDD:278494
LNR 1 1387..1427
Notch 1425..1459 CDD:278494 10/26 (38%)
LNR 2 1428..1458 9/25 (36%)
Notch 1464..1500 CDD:278494 11/52 (21%)
LNR 3 1467..1505 8/54 (15%)
NOD 1508..1557 CDD:284282 12/58 (21%)
NODP 1578..1637 CDD:284987 18/82 (22%)
ANKYR <1777..1893 CDD:223738 33/143 (23%)
ANK <1779..1892 CDD:238125 32/140 (23%)
ANK repeat 1788..1836 CDD:293786 15/72 (21%)
ANK repeat 1838..1869 CDD:293786 7/34 (21%)
ANK 1 1838..1867 6/32 (19%)
Ank_5 1858..1913 CDD:290568 15/48 (31%)
ANK 1866..1992 CDD:238125 13/37 (35%)
ANK repeat 1871..1903 CDD:293786 12/32 (38%)
ANK 2 1871..1901 11/30 (37%)
ANK repeat 1905..1936 CDD:293786
ANK 3 1905..1934
Ank_2 1910..2002 CDD:289560
ANK repeat 1938..1969 CDD:293786
ANK 4 1938..1967
ANK repeat 1971..2002 CDD:293786
ANK 5 1971..2000
DUF3454 2212..2273 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.