DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and NOTCH2

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_077719.2 Gene:NOTCH2 HGNCID:7882 Length:2471 Species:Homo sapiens

Alignment Length:587 Identity:119/588 (20%)
Similarity:178/588 (30%) Gaps:195/588 (33%)


  Fly   246 YDEEYME----NQCHERAIESD----------------NCSYELYANSSFIYAEARYLGLSQKEC 290
            |.||.::    |.|...|..||                ||.||:                  .||
Human  1145 YCE
EQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEV------------------DEC 1191

  Fly   291 QAMCSHEAKFYCQ--GVSFYYVNQLSLSEC------LLHSEDI--VSLGPRSLKLRENSVYMRRV 345
            |..       .||  |.....||....| |      ||..|:|  .:.||..|         ...
Human  1192 QNQ-------PCQNGGTCIDLVNHFKCS-CPPGTRGLLCEENIDDCARGPHCL---------NGG 1239

  Fly   346 KCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKDCLARGSG---NGSVLLTLQIGSEVKENRC 407
            :|:| |:                       ..:|..||...:|   .|.:       :|...|.|
Human  1240 QCMD-RI-----------------------GGYSCRCLPGFAGERCEGDI-------NECLSNPC 1273

  Fly   408 ---GILRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDSS 469
               |.|...::|.:|.....||.    ...:.:|..|...::.|: :..|.::..::.|..:...
Human  1274 SSEGSLDCIQLTNDYLCVCRSAF----TGRHCETFVDVCPQMPCL-NGGTCAVASNMPDGFICRC 1333

  Fly   470 EPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPH---PHPSISLQILDLSHQHETNDVQIGQNL 531
            .|..|....:||....: ....|..||  :::||.   |.|.      |......::..|.|.:.
Human  1334 PPGFSGARCQSSCGQVK-CRKGEQCVH--TASGPRCFCPSPR------DCESGCASSPCQHGGSC 1389

  Fly   532 ELQIVAEY-----SPQQLAEHMELQLAPLPDFRATSLVAKTADNENFVLLIDE----RGCPTD-- 585
            ..|....|     :|.......||..||.....||.|....||..... :.||    ..|..|  
Human  1390 HPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDG-VCDEACNSHACQWDGG 1453

  Fly   586 -------------ASVFPALERVHTASRSM---LRARFHAFKFSGTANV-SFD------VKIRFC 627
                         :|..|..:.::.....:   :...|..|:..|.:.. .:|      .|...|
Human  1454 DCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNSKTCKYDKYCADHFKDNHC 1518

  Fly   628 VERCSPSNCISSSWQRRRRQADQPDRRPEDLRVQNPVYISTVVDVAPQPD--------NFTRSQE 684
            .:.|:...|   .|......||||:...|          .|:|.|...|.        :|.|:..
Human  1519 DQGCNSEEC---GWDGLDCAADQPENLAE----------GTLVIVVLMPPEQLLQDARSFLRALG 1570

  Fly   685 ELPLNYNIRVHGPDQSNTNSY-LYGERGVLL-----------------IAGIDDPLHLDN-VCIN 730
            .| |:.|:|:....|.....| .|||:...:                 :||....|.:|| .|:.
Human  1571 TL-LHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAGSKVFLEIDNRQCVQ 1634

  Fly   731 QS 732
            .|
Human  1635 DS 1636

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 4/13 (31%)
PAN_AP_HGF 270..344 CDD:238532 17/84 (20%)
NOTCH2NP_077719.2 EGF_CA 182..218 CDD:238011
EGF_CA 260..296 CDD:238011
EGF_CA 298..335 CDD:238011
EGF_CA 415..454 CDD:238011
EGF_CA 456..492 CDD:238011
EGF_CA 495..530 CDD:238011
EGF_CA 532..568 CDD:238011
EGF_CA 570..604 CDD:238011
EGF_CA 608..643 CDD:238011
EGF_CA 645..679 CDD:238011
EGF_CA 682..717 CDD:238011
EGF_CA 757..793 CDD:238011
EGF_CA 795..831 CDD:238011
EGF_CA 873..909 CDD:238011
EGF_CA 911..947 CDD:238011
EGF_CA 949..985 CDD:238011
EGF_CA 987..1022 CDD:238011
EGF_CA 1026..1061 CDD:238011
EGF_CA 1117..1147 CDD:238011 1/2 (50%)
EGF_CA 1151..1185 CDD:238011 7/34 (21%)
EGF_CA 1188..1223 CDD:238011 12/61 (20%)
EGF_CA 1225..1262 CDD:238011 11/70 (16%)
EGF_CA 1264..1302 CDD:238011 9/49 (18%)
EGF_CA <1312..1343 CDD:238011 5/32 (16%)
Notch 1423..1456 CDD:278494 9/34 (26%)
Notch 1463..1497 CDD:278494 4/34 (12%)
Notch 1501..1534 CDD:278494 6/36 (17%)
NOD 1540..1591 CDD:284282 13/62 (21%)
NODP 1620..1673 CDD:284987 6/18 (33%)
Ank_2 <1820..1907 CDD:289560
ANK repeat 1827..1874 CDD:293786
ANK 1872..1997 CDD:238125
ANK repeat 1877..1907 CDD:293786
Ank_2 1881..1974 CDD:289560
ANK 1938..2062 CDD:238125
ANK repeat 1943..1974 CDD:293786
Ank_2 1948..2040 CDD:289560
ANK repeat 1976..2007 CDD:293786
ANK repeat 2009..2040 CDD:293786
Chorion_3 <2292..2421 CDD:253174
DUF3454 2381..2444 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.