DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and NOTCH1

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_060087.3 Gene:NOTCH1 HGNCID:7881 Length:2555 Species:Homo sapiens

Alignment Length:244 Identity:54/245 (22%)
Similarity:79/245 (32%) Gaps:85/245 (35%)


  Fly    39 LHQLQLQKIVGFRPPLEYLNADNRIYGPEMVSNFKTRNGQQEL--PVSQVCWRICNE---DPDCI 98
            :::.|.:...||...|...:.|.....|       .:||.:.|  |.:..|  :|.|   ...|.
Human   509 INEFQCECPTGFTGHLCQYDVDECASTP-------CKNGAKCLDGPNTYTC--VCTEGYTGTHCE 564

  Fly    99 AYVHLLDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYEKTCLRVPDACRGRLWALTKIPGS 163
            ..:...|.|.||..|                 ..||.|.|   |||     ||         ||.
Human   565 VDIDECDPDPCHYGS-----------------CKDGVATF---TCL-----CR---------PGY 595

  Fly   164 TLVYHSKKTISTLVTR----------RECAERCFFETQFRCLSASFAPSYRNNRERFRGEAGPGQ 218
            | .:|.:..|:...::          |:.|..||      ||..:..|:...|.:....      
Human   596 T-GHHCETNINECSSQPCRHGGTCQDRDNAYLCF------CLKGTTGPNCEINLDDCAS------ 647

  Fly   219 RPSP-RLGRCMLSDRDKTVQPDAFRAAPYDEEYMENQCHERAIESDNCS 266
              || ..|.|:    ||.   |.:..| .:..|..:.|:   |..|.|:
Human   648 --SPCDSGTCL----DKI---DGYECA-CEPGYTGSMCN---INIDECA 683

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 22/107 (21%)
PAN_AP_HGF 270..344 CDD:238532
NOTCH1NP_060087.3 EGF_CA 142..175 CDD:238011
EGF_CA 178..216 CDD:238011
EGF_CA 223..255 CDD:238011
EGF_CA 257..293 CDD:238011
EGF_CA 295..332 CDD:238011
EGF_CA 335..370 CDD:238011
EGF_CA 412..450 CDD:238011
Interaction with DLL4. {ECO:0000250|UniProtKB:Q07008} 420..421
Interaction with DLL4. {ECO:0000250|UniProtKB:Q07008} 448..452
EGF_CA 452..488 CDD:238011
EGF_CA 490..526 CDD:238011 4/17 (24%)
EGF_CA 528..564 CDD:238011 10/45 (22%)
EGF_CA 566..601 CDD:238011 18/70 (26%)
EGF_CA 603..639 CDD:238011 8/42 (19%)
EGF_CA 678..713 CDD:238011 2/7 (29%)
EGF_CA 717..750 CDD:238011
EGF_CA 755..789 CDD:238011
EGF_CA 791..827 CDD:238011
EGF_CA 869..905 CDD:238011
EGF_CA 907..943 CDD:238011
EGF_CA 945..981 CDD:238011
EGF_CA 988..1019 CDD:238011
EGF_CA 1021..1057 CDD:238011
EGF 1063..1093 CDD:278437
EGF_CA 1146..1180 CDD:238011
EGF_CA 1184..1219 CDD:238011
EGF_CA <1238..1265 CDD:238011
EGF_CA 1267..1305 CDD:238011
NL 1442..1479 CDD:197463
LNR 1. {ECO:0000255|PROSITE-ProRule:PRU00525} 1449..1489
Notch 1487..1522 CDD:278494
LNR 2. {ECO:0000255|PROSITE-ProRule:PRU00525} 1490..1531
Notch 1525..1561 CDD:278494
LNR 3. {ECO:0000255|PROSITE-ProRule:PRU00525} 1532..1571
NOD 1567..1618 CDD:284282
NODP 1672..1729 CDD:284987
Interaction with PSEN1. {ECO:0000269|PubMed:30598546} 1728..1760
Ank_2 <1873..1958 CDD:289560
ANK repeat 1880..1925 CDD:293786
ANK 1922..2034 CDD:238125
ANK repeat 1927..1958 CDD:293786
ANK 1. {ECO:0000255} 1927..1956
Ank_2 1932..2025 CDD:289560
HIF1AN-binding. {ECO:0000250} 1947..1955
ANK repeat 1960..1991 CDD:293786
ANK 2. {ECO:0000255} 1960..1990
ANK 1989..2113 CDD:238125
ANK repeat 1994..2025 CDD:293786
ANK 3. {ECO:0000255} 1994..2023
Ank_2 1999..2091 CDD:289560
HIF1AN-binding. {ECO:0000250} 2014..2022
ANK repeat 2027..2058 CDD:293786
ANK 4. {ECO:0000255} 2027..2056
ANK repeat 2060..2091 CDD:293786
ANK 5. {ECO:0000255} 2060..2089
ANK 6 2095..2122
Med25_SD1 <2429..2514 CDD:288132
DUF3454 2479..2540 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.