DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and nompA

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_524831.2 Gene:nompA FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster

Alignment Length:677 Identity:148/678 (22%)
Similarity:221/678 (33%) Gaps:237/678 (35%)


  Fly   181 ECAERCFFETQFRCLSASF---APSYRNNRERFRGEAGPGQRPSPRLGRCMLSDRDKTV----QP 238
            :|...|.....|.|.|.::   |.|...:|:|.|      .|.||   .|.|||||...    .|
  Fly   942 QCERECIESRDFVCRSFNYRDSAASGYEDRDRDR------DRDSP---NCELSDRDSRELDIHDP 997

  Fly   239 DAFRAAPYDEEYMENQCHERAIESDNCSYELYANSSFIYAEARYLGLSQKECQAMCSHEAKFYCQ 303
            ..|.|:.||                  .||            |.:|.|..|              
  Fly   998 GTFDASNYD------------------FYE------------RS
IGRSDGE-------------- 1018

  Fly   304 GVSFYYVNQLSLSECLLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDW 368
                                                       |:||...|..:.|.......:.
  Fly  1019 -------------------------------------------CMDVTQTCNEEGMEFTIRTPEG 1040

  Fly   369 FVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQNN 433
            |:|:||.......|..|  |||..:..|::........||       ||.|..| ::.:||:|.:
  Fly  1041 FLGRIYTYGFYDRCFFR--GNGGTVNVLRLSGPQGYPDCG-------TQRYGDT-LTNIVVVQFS 1095

  Fly   434 PNVQTQGDRLIKVGCI---QSNATTSLGVSVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGVV 495
            .||||..|:...:.||   ...|..|.|.    ....|..|:|        :||    .|.|..:
  Fly  1096 DNVQTSRDKRYNLTCIFRGPGEAVVSSGY----IGAGSGSPIP--------IEY----LPAENTL 1144

  Fly   496 HYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNLELQIVAEYSPQQLAEHMELQLAPLPDFRA 560
                        |..:::..|.....|..:.:|..|..::.|    |....|       :.|..|
  Fly  1145 ------------SSKVRLSILYQGRPTTTIAVGDPLTFRLEA----QDGYNH-------VTDIFA 1186

  Fly   561 TSLVAKTADNENFVLLIDERGCPTDASVFPALERVHTASRSMLRARFHAFKFSGTANVSFDVKIR 625
            |::||:...:...:.|||..|||.|..|||.|:::...  ..|.|||:|||...:..:.|:..:|
  Fly  1187 TNVVARDPYSGRSIQLIDRFGCPVDPFVFPELDKLRDG--DTLEARFNAFKIPESNFLVFEATVR 1249

  Fly   626 FCVERCSPSNC------ISSSWQRRRRQADQPD-RRPE----------------DLRVQNPVYIS 667
            .|.|.|.|:.|      ...|:.||||..:..: ..||                ::.|.|...:|
  Fly  1250 SCREGCQPAYCPGPAGRQEPSFGRRRRSLNTTEIPEPEALALEGSSQLEASTLDEVTVVNSTTVS 1314

  Fly   668 TVVDVAP----QPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVL--------LIAGIDD 720
            ..:...|    |....|:..||           |:|......::..|..:        |:|.:  
  Fly  1315 ATLGQVPLNETQLGEKTKETEE-----------PEQVREMIEVFETREEIEKESYPRKLVAPV-- 1366

  Fly   721 PLHLDNVCIN----QSLLIALFIFW-LICQVALLFGCGMVLQRYRRLAKLEDERR---------- 770
                :.||:.    ..|:.|:.:.. |:..:.|:.|.|     |||..|...:.|          
  Fly  1367 ----ETVCMTPAEYHGLITAIILLMILLFSITLVAGLG-----YRRYWKSISKNRLVDRHSPIHS 1422

  Fly   771 --------RLHEEYLEARRVHWADQGG 789
                    |.||.:.|...:...:.||
  Fly  1423 LGHSHSSIRTHERFTEIGHMPNLNGGG 1449

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 24/81 (30%)
PAN_AP_HGF 270..344 CDD:238532 4/74 (5%)
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532
PAN_AP_HGF 244..>303 CDD:238532
PAN_AP_HGF 349..424 CDD:238532
PAN_AP_HGF 914..1011 CDD:238532 27/108 (25%)
ZP 1025..1264 CDD:214579 76/290 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D200714at33208
OrthoFinder 1 1.000 FOG0000109
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47327
RoundUp 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.