DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and m

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_572747.1 Gene:m FlyBaseID:FBgn0002577 Length:682 Species:Drosophila melanogaster

Alignment Length:331 Identity:72/332 (22%)
Similarity:110/332 (33%) Gaps:66/332 (20%)


  Fly   313 LSLSEC--LLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYA 375
            |..|.|  :||....:.:....|...|....|..:..|:  |.|.:|.|.:.......|.|.:.:
  Fly    14 LRFSSCIFILHLMFSLVIAGNELWPMERPDGMPNIVSLE--VMCGKDHMDVHLTFSHPFEGIVSS 76

  Fly   376 SMHSKD--CLARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQNNPNVQT 438
            .....|  |:......|....:.:|    ..:|||      ...:....|....||:|.:.::..
  Fly    77 KGQHSDPRCVYVPPSTGKTFFSFRI----SYSRCG------TKPDLNGQFYENTVVVQYDKDLLE 131

  Fly   439 QGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGV---VHYNSS 500
            ..|...::.|...|          |....:|:| |..||   .|:..:..|..:.|   :.....
  Fly   132 VWDEAKRLRCEWFN----------DYEKTASKP-PMVIA---DLDVIQLDFRGDNVDCWMEIQHG 182

  Fly   501 TGPHPHPSISLQILDLSHQHETNDVQIGQNLELQI-VAEYSPQQLAEHMELQLAPLPDFRATSLV 564
            .||...|...:             |.:|..|.|.: :.:|..:.             |.|..|.|
  Fly   183 KGPWAPPVSGI-------------VPLGSTLTLVVAINDYRGEF-------------DMRVKSCV 221

  Fly   565 AKTADNENFVL-LIDERGC---PTDASVFPALERVHTASRSMLRARFHAFKFSGTANVSFDVKIR 625
            |  :|....|: |.||.||   |...|.|.........:..:..|.||||||....:|....|:.
  Fly   222 A--SDGSGHVINLSDEFGCVLRPKMISRFLKARAPDERATVITYAFFHAFKFPDALSVHIKCKVE 284

  Fly   626 FCVERC 631
            .|...|
  Fly   285 ICRHGC 290

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 8/33 (24%)
mNP_572747.1 ZP 55..286 CDD:214579 60/283 (21%)
Zona_pellucida <194..287 CDD:278526 30/108 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139555248
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.