DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and nyo

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_651871.2 Gene:nyo FlyBaseID:FBgn0039852 Length:805 Species:Drosophila melanogaster

Alignment Length:723 Identity:168/724 (23%)
Similarity:279/724 (39%) Gaps:156/724 (22%)


  Fly    87 CWRICNEDPDCIAYVHLLDTDECHGYSYFERTSRYLAIS---GELPLVADGEAVFYEKTCLRVPD 148
            |...|..:..|.|..:  :|..|   ..|:.|:..|..|   .:.|:.    .::.:|:||.|..
  Fly   148 CLEACQSNESCSAVNY--ETGLC---VLFKTTADKLPGSLSRSQFPVF----TIYAQKSCLGVRP 203

  Fly   149 ACRGRLWALTKIPGSTLVYHSKKTISTLVTRRECAERCFFETQFRCLSASFAPSYRNNRERFRGE 213
            .  .:.|.:.::.|..|..|.|.: .|:::||:|.|.|..||:|.|.||::   ||::       
  Fly   204 C--SKAWCIDRVQGYRLPEHVKSS-QTVLSRRDCLELCLGETEFTCRSANY---YRHS------- 255

  Fly   214 AGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYD-EEYMENQCHERAIESDNCSYELYANSSFIY 277
                       |.|.|||.|:..........||| .:|:||.|.|.  .|..|.::..:......
  Fly   256 -----------GLCELSDMDRITLSAGGSVEPYDGADYLENNCAEE--PSKLCEFKRISGKILKT 307

  Fly   278 AEARYLGLSQ-KECQAMCSHEAKFYCQGVSFYYVNQLSLSECLL--HSEDIVS--LGPRSLKLRE 337
            .::.|..::. .||:.:|.: :.:.|..   |..|......|.|  ||...::  :.| .|.:.|
  Fly   308 VDSVYQDINTIDECRDLCLN-SPYRCHS---YDYNDTGDMVCRLSHHSRATLTDVMDP-YLDVPE 367

  Fly   338 NSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEV 402
            .:.| ....|.:|.:.|...||..|......|.||:||....|.|..  :.|.|:....::|  .
  Fly   368 AATY-ELSACYNVSIECRSGEMITKIRTSKLFDGKVYAKGAPKSCAV--NVNNSLEFDFRMG--Y 427

  Fly   403 KENRCGILRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVD 467
            .:..|.:.::     .|.|....  :|||::..:.|..|..:.|.| |.:.|..  ..:.|..:.
  Fly   428 NDLECNVRQS-----AYGRYMND--IVIQHHDMIVTSSDLGLAVSC-QYDLTNK--TVLNDVDLG 482

  Fly   468 SSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNLE 532
            .:..:.|:::.|.:::                      .|::.::|............::|..|.
  Fly   483 VTGEIESSLSEEITID----------------------SPNVIMKITSRDGSDMKRMAEVGDPLA 525

  Fly   533 L--QIVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADNENFVLLIDERGCPTDASVFPALERV 595
            |  :||...||.::.              ...|||....:...:.|||..|||||..:...::::
  Fly   526 LRFEIVEPNSPYEIF--------------VRELVAMDGSDSAEITLIDANGCPTDQYIMGTIQKL 576

  Fly   596 HTASRSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNCISS-----------SWQRRRRQAD 649
             ..:|.:|.::|.||||..:..|.|...:..|:.||.|..|.|.           |:.|::|...
  Fly   577 -AQNRKVLLSQFDAFKFPSSEVVQFRALVTPCIPRCEPVICDSEDGASGELKSLVSYGRKKRSVL 640

  Fly   650 QPDRRPEDLRVQNPVYIST--VVDVAPQPDNFTRSQE-ELPLNYNIR------VHGPDQSNTNSY 705
            ......|.|       |||  ..||.|..||....|. ::...:..:      .||.| |..:..
  Fly   641 NGTDGAEFL-------ISTRHRRDVGPVDDNILLMQSIQITDKFGFQPEDGTTTHGND-SGPHEK 697

  Fly   706 LYGERGVLLIAGI-DDPLHLDNVCINQSLLIALFIFWLICQVALLFGCGMVLQRYRRLAKLEDER 769
            .|        ||: .|.|    .|:|...||.....:|:.|:: :||....:|           |
  Fly   698 AY--------AGVAQDKL----TCLNGYGLIMAGALFLLAQLS-IFGIWKTVQ-----------R 738

  Fly   770 RRLHEEYL 777
            |...|.||
  Fly   739 RTSKERYL 746

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 30/97 (31%)
PAN_AP_HGF 270..344 CDD:238532 15/79 (19%)
nyoNP_651871.2 PAN_1 121..198 CDD:278453 12/59 (20%)
PAN_AP_HGF 208..286 CDD:238532 31/100 (31%)
PAN_1 295..374 CDD:278453 16/85 (19%)
ZP 382..618 CDD:214579 63/287 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47327
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.