DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and mey

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001287622.1 Gene:mey FlyBaseID:FBgn0039851 Length:774 Species:Drosophila melanogaster

Alignment Length:694 Identity:164/695 (24%)
Similarity:265/695 (38%) Gaps:148/695 (21%)


  Fly    87 CWRICNEDPDCIAYVHLLDTDECHGYSYFERTSRYLAIS---GELPLVADGEAVFYEKTCLRVPD 148
            |...|..:..|.|..:  :|..|   ..|..|:..|..|   .:.|:.    .|:.:|:|..|..
  Fly   173 CLEACQANESCSAVNY--ETGLC---VMFRSTADQLPGSLSRSQYPVF----TVYAQKSCFGVRP 228

  Fly   149 ACRGRLWALTKIPGSTLVYHSKKTISTLVTRRECAERCFFETQFRCLSASFAPSYRNNRERFRGE 213
            .  .:.|.:.::.|..|...:|.: .::.|||:|.|.|..||:|.|.||::   |.::       
  Fly   229 C--SKAWCIDRVQGYRLPERAKAS-QSVATRRDCIELCLGETEFTCRSANY---YAHS------- 280

  Fly   214 AGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYD-EEYMENQCHERAIESDNCSYELYANSSFIY 277
                       |.|.|||.|:....|....|.|| .:|:||.|.|.  .|..|.::..|......
  Fly   281 -----------GLCELSDMDRITLSDEANIAAYDGADYLENNCAEE--PSKLCEFKRVAGRILKT 332

  Fly   278 AEARYLGL-SQKECQAMCSHEAKFYCQGVSFYYVNQLSLSECLL--HSE-DIVSLGPRSLKLREN 338
            .::.:..: :..||:.:|. .|.|.|..   |..|:.....|.|  ||. .:..|....|.:.|.
  Fly   333 VDSVHQNVQTLDECRDLCL-TAPFRCHS---YDYNETGELVCRLSHHSRATLTDLSEPYLSIEEA 393

  Fly   339 SVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEVK 403
            :.| .:..|.:|.:.|...||..|......|.||:||....|.|..  :.|.|:...|::  ...
  Fly   394 ATY-EQSACYNVSIDCRSGEMITKIRTSKLFDGKVYAKGAPKSCAV--NVNNSLEFDLKM--RYN 453

  Fly   404 ENRCGILRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDS 468
            :..|.:.::     .|.|....  :|||::..:.|..|..:.|.| |.:.|....|:..|..|..
  Fly   454 DLECNVRQS-----AYGRYMND--IVIQHHDMIVTSSDLGLAVSC-QYDLTNKTVVNNVDLGVTG 510

  Fly   469 SEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNLEL 533
            .        :||:|.       .|.:|         ..|::.::|............::|..|.|
  Fly   511 E--------IESTLS-------EEIIV---------DSPNVIMKITARDGSDMKRIAEVGDPLAL 551

  Fly   534 --QIVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADNENFVLLIDERGCPTDASVFPALERVH 596
              :||...||.::.              ...|||....:...:.|||..|||||..:..|:::: 
  Fly   552 RFEIVDANSPYEIF--------------VRELVAMDGTDSAEITLIDANGCPTDQYIMSAMQKL- 601

  Fly   597 TASRSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNCISS---------SWQRRRRQ----- 647
            ..:|.:|.::|.||||..:..|.|...:..|:.||.|..|.:.         |:.||:|.     
  Fly   602 ANNRKVLLSQFDAFKFPSSELVQFRALVTPCIPRCEPVICDNDENGELKSLLSYGRRKRSVLNGT 666

  Fly   648 -----ADQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLY 707
                 |.:.:|:..|:..|           |...:|....| .:.:......:|.|....:.   
  Fly   667 DGVELAIKSERQKRDVSHQ-----------AAGDENILLVQ-SIQITDKFAFNGADAPGGSG--- 716

  Fly   708 GERGVLLIAGIDD--PLHLD-----NVCIN-QSLLIALFIFWLI 743
            .|.|     |:|.  .|.||     :.||| ...:||..:|.|:
  Fly   717 SEAG-----GLDGLAKLQLDLGTKSDTCINGYGFIIAGALFLLL 755

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 29/97 (30%)
PAN_AP_HGF 270..344 CDD:238532 17/78 (22%)
meyNP_001287622.1 PAN_1 146..223 CDD:278453 13/59 (22%)
PAN_AP_HGF 233..311 CDD:238532 30/100 (30%)
PAN_AP_HGF 319..>380 CDD:238532 14/65 (22%)
ZP 408..642 CDD:214579 69/285 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S12391
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47327
RoundUp 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.