DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and CG12592

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_731474.1 Gene:CG12592 FlyBaseID:FBgn0037811 Length:674 Species:Drosophila melanogaster

Alignment Length:553 Identity:106/554 (19%)
Similarity:187/554 (34%) Gaps:135/554 (24%)


  Fly   243 AAPYDEEY----------MENQCHERAIESDNCSYELYANSSFIYAEARYLGLSQKECQAMCSHE 297
            |:|.|||:          .||:. |:.....|||    :|:|.:...|:.|.:|:::.       
  Fly   100 ASPSDEEHDGKVQTNDDSSENKT-EKPKNQSNCS----SNASKLSEAAQLLNVSEEKS------- 152

  Fly   298 AKFYCQGVSFYYVNQLSLSECLLHSEDIVSLGPRSLKLRENSVYMRRVKCLDVRVF------CTR 356
                            |:||..|.....|:|.    :|.::..:.:....||:.|.      ...
  Fly   153 ----------------SISETELERSRQVALN----ELNKSERFNKTETQLDISVMEVDSSDHDE 197

  Fly   357 DEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQI--GSEVKENRC---------GIL 410
            :|.|.|...|:  ...:|..:.|.|...:...........:.  .||:|::..         |..
  Fly   198 EEKTEKVGAKN--NRSLYEIVDSDDEEEQDQDQSDAAKPAESENHSEIKKSTSFMDQMSGAKGNK 260

  Fly   411 RAYEMTQEYQRTFISALVVIQNNP-----NVQTQGDRLIKVGCIQSN--ATTSLGVSVRDSSVDS 468
            ..||:...|:          ..:|     |.::..|:..:.|....:  |.|.:....:.|.:.|
  Fly   261 SVYEIMDSYE----------TEDPKEAGKNEESDKDKPAENGKSDKDKQAETEMSDEDKPSEIKS 315

  Fly   469 SEPVPSAI-------AL-----ESSLEYTEHMFPHEGVVHYNSSTGPH-PHPSISLQILDLSHQH 520
            ...:..:|       ||     .|.|.:.|.||   ..:..:.....| |.|.::.:...|..:.
  Fly   316 PSTIKKSIISTADEEALLAELASSDLSHLEKMF---NPLQKSRRQSLHVPSPELAAKNPKLRRRS 377

  Fly   521 ETNDVQIGQNL-----ELQIVAEY----------------SPQQLAEHMEL--QLAPLPDFRATS 562
            |.  |::|.:.     .:.:|||.                :|:.| |.||:  :...|......|
  Fly   378 ER--VEVGNDFCPSQSFVDMVAEKKRQKNKRKRLSKSLSGAPEDL-EEMEIKHERKRLKSSHGAS 439

  Fly   563 LVAKTADNENFVLLIDERGCPTDASV----FPALERVHTASRSMLRARFHAFKFSGTANVSFDVK 623
            ..:...||||..:.:.|.. .:|..|    .|..|:..|:|.....:.......|....:..|||
  Fly   440 TDSMEEDNENETMTVAEEH-HSDGEVSNGEVPIEEKPTTSSEKPSASELPEEGNSAPPALKKDVK 503

  Fly   624 IRFCVERCSPSNCISSSWQRRRRQADQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTRSQEELPL 688
             |....|.:.|:.::.....:..:| :|......|..|.||..........:.....:.||..||
  Fly   504 -RLQAARQAVSHAVNLLAPPKATEA-EPRTLSRKLSPQPPVVDKKSAKQKKKGKKKQKPQEASPL 566

  Fly   689 NYNIRVHGPDQSNTNSYLYGERGVLLIAGIDDP 721
            .      ..|:.|....:....|.:.:  :|:|
  Fly   567 K------SSDEENHGHRIRTNAGYVTV--VDEP 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 7/22 (32%)
PAN_AP_HGF 270..344 CDD:238532 12/74 (16%)
CG12592NP_731474.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.