DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and sle

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_731472.1 Gene:sle FlyBaseID:FBgn0037810 Length:1430 Species:Drosophila melanogaster

Alignment Length:593 Identity:112/594 (19%)
Similarity:193/594 (32%) Gaps:188/594 (32%)


  Fly   105 DTDECHGYSYFERTSRYLA-----ISGELPLVADGE--AVFYEK---TCLRVPDACRG---RLWA 156
            :|.|....|..:||:|..|     :..:|.|..:.|  .|..||   :...||...:|   |..:
  Fly    76 ETPEPTTPSSVKRTARTPAKNTRSVRQQLTLTEEPEENEVKQEKPSPSPSPVPKEGKGKAQRKPS 140

  Fly   157 LTKIPGSTL----------VYHSKKTISTLVTRRECAERCFFETQFRCLSASFAPSYRNNRERFR 211
            ::..||.||          |..|......:.||                |:|..|...|:..:..
  Fly   141 VSPSPGRTLTPNQQSDEKRVTRSMSQTPPMPTR----------------SSSNTPRDLNDSPKVE 189

  Fly   212 GEAGPGQRPSPRLG-RCMLSDRDKTVQPDAFRAAP--YDEEYMENQCHERAIESDNCSYELYANS 273
            .:|.|..:.:|::. |......||.......:|.|  ..:|..:|    ..:|..|.|       
  Fly   190 QKAKPNIKTTPKVAVRLEKLSMDKFSGKKMEKAKPLIVPDELKDN----GVVEEQNKS------- 243

  Fly   274 SFIYAEARYLGLSQKECQAMCSHEA----------KFYCQGVSFYYVNQLSLSECLLHSED---- 324
                       :::...||..:||:          .|.   .||..::::..|...||.::    
  Fly   244 -----------ITEAHSQAPETHESAQPDKDAGKQSFL---KSFTTLSKIQGSSKALHPDESADT 294

  Fly   325 IVSLGPRSL--KLRENSVYMRRVKCLD-----VRVFCTRDEMTIKYNPKDWFVGKIYASMHSKDC 382
            |..:.|.|.  |:.||         :|     :||...:.|..|:...|...||.  ..:..|| 
  Fly   295 ITKITPTSTSKKIEEN---------MDDVFETLRVESPKVERKIETLQKVHTVGT--PEIKEKD- 347

  Fly   383 LARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQ---NNPNVQTQGDRLI 444
                       ..:.:.:|:|...       |..|:.:...|.:.|..|   ::|.::.:.|...
  Fly   348 -----------EPVGVDNEIKTKT-------ETPQKIEPPIIESKVETQQLIDHPQIEKKRDTPQ 394

  Fly   445 KVGCIQSNATTSLGVSVRDSSVD-----------------SSEPVPSAIALE-SSLEYTEHMFPH 491
            .|..:....|:    ..:|.|::                 :.|||.....|| ..|:..|.:||.
  Fly   395 NVSTVDLMDTS----PEKDESMEDQEFLDAEDSIVQLEPQTDEPVEKPKELEFVDLDDDEPVFPS 455

  Fly   492 EGVVHYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNLELQIV---AEYSP----------QQ 543
            |...:...|...||..|:.        ..:.|.:.:.:.:.|..:   |..||          ..
  Fly   456 EAPKYVEDSKEVHPDDSMD--------DDKQNKIDVTEVIHLPSIRARAVRSPAVEQKKSVDFNN 512

  Fly   544 LAEHMELQ------------------LAPLPDFRATSLVAKTADNENFVLLIDERGCPTDASVFP 590
            ..:.:|::                  |.|.|:......:.|..::...:|...|||...      
  Fly   513 DTDDLEVEKKRFPKTPGREKVPVCRILTPKPETPLKLALQKGRNSSTPILKDQERGLSN------ 571

  Fly   591 ALERVHTA 598
            :.|.:|.|
  Fly   572 STEELHPA 579

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 22/109 (20%)
PAN_AP_HGF 270..344 CDD:238532 16/90 (18%)
sleNP_731472.1 MDN1 <289..716 CDD:227596 60/340 (18%)
MDN1 <685..960 CDD:227596
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.