DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and Notch4

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_008770962.1 Gene:Notch4 RGDID:1303282 Length:1999 Species:Rattus norvegicus

Alignment Length:738 Identity:138/739 (19%)
Similarity:212/739 (29%) Gaps:301/739 (41%)


  Fly   192 FRCLSASFAPSYR------NNRERFRGE-------AGPGQRPSPRLGRCMLSDRDKTVQPDAFRA 243
            |:|.....:|..|      |..|...|:       :|||.....  |.|.|.      .||.::.
  Rat  1191 FQCTCPPDSPGPRCQRPGANGCEGRGGDGACDAGCSGPGGDWDG--GDCSLG------VPDPWKG 1247

  Fly   244 APYDEE----YMENQCHERAIESDNC---------------SYELYANSSFIYAEARYLGLSQKE 289
            .|...:    :.:.:||.:. :|:.|               :|:.|....|      :.|..:|.
  Rat  1248 CPPHSQCWLLFRDGRCHPQC-DSEECLFDGYDCEIPPTCTPAYDQYCRDHF------HNGHCEKG 1305

  Fly   290 C-QAMCSHEAKFYCQGVSFYYVNQLSLSECLLHSED---------IVSLGPRSLKLRENSVYMRR 344
            | .|.|..:.                 .:|....:|         :|.|.|.:|.  :..:.:.|
  Rat  1306 CNNAQCGWDG-----------------GDCRPEGDDSEGGPSLALLVVLSPPALD--QQLLALAR 1351

  Fly   345 VKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEVKENRCGI 409
            |..|.:||..             |               .|....|..::....|:..||...|.
  Rat  1352 VLSLTLRVGL-------------W---------------VRKDSEGRNMVFPYPGTRAKEELSGT 1388

  Fly   410 LRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSV------------- 461
                ..:..::|          ..|:.||.|.....:|   :.....:||.:             
  Rat  1389 ----RDSSSWER----------QAPHTQTPGKETESLG---AGFVVVMGVDLSRCGPEHPASRCP 1436

  Fly   462 RDSSVDSSEPVPSAIALESSLEYTEHMFPHEG---VVHYNSSTG------PHP---HPSISLQIL 514
            |||.:     :...:|..:::...|.:.|  |   ..|..:.||      |.|   .|.:.:.:|
  Rat  1437 RDSGL-----LLRFLAAMAAVGALEPLLP--GPLLAAHPQAGTGSPATRLPWPILCSPVVGVLLL 1494

  Fly   515 DLSHQHETNDVQIGQNLELQIVAEYSPQQLAEHMELQLAP----------LPDFRATSLVAKTAD 569
            .|           |..|.||::.    ::..||..|.|.|          .|..|...|   ..|
  Rat  1495 AL-----------GALLVLQLIR----RRRREHGALWLPPGFIRRPQTQQAPHRRRPPL---GED 1541

  Fly   570 NENFVLL-----IDERG---C--PTDASVFPALERVHTASRSM---LRARFHAFKFSGTANVSFD 621
            |.....|     :||.|   |  |.:...    |:..:|||..   ||        ||...:...
  Rat  1542 NIGLKALKPEAEVDEDGVVMCSGPEEGEA----EKTASASRCQLWPLR--------SGCEGLPQA 1594

  Fly   622 VKIRFCVERCSPSNCISSSWQRRRRQADQPD-----------------------RRPEDLRVQNP 663
            |.:      ..|..|          :::.||                       ...:.|.:.||
  Rat  1595 VML------TPPQEC----------ESELPDSDTCGPDGVTPLMSAVFCGGVQSTTVQRLGLGNP 1643

  Fly   664 VYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAGID--------- 719
            .....::|....|...|....|.||:...|...|..:..          ||.||.:         
  Rat  1644 EPWEPLLDRGACPQAHTVGTGETPLHLAARFSRPTAARR----------LLEAGANPNQPDRAGR 1698

  Fly   720 DPLHLDNVCINQSLLIALFIFWLICQVALLFGCGMV----------LQRYRRLAKLEDERRRLHE 774
            .|||.......:.          :||:.|......|          |....||| :||    |.|
  Rat  1699 TPLHTAVAADARE----------VCQLLLASRQTAVDARTDDGTTPLMLAARLA-VED----LVE 1748

  Fly   775 EYLEAR------------RVHWA 785
            |.:.||            .:|||
  Rat  1749 ELIAARADVGARDKRGKTALHWA 1771

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 16/80 (20%)
PAN_AP_HGF 270..344 CDD:238532 13/84 (15%)
Notch4XP_008770962.1 EGF_CA 229..>262 CDD:284955
EGF_CA 349..387 CDD:238011
EGF_CA 390..425 CDD:238011
EGF_CA 467..508 CDD:238011
EGF_CA 510..546 CDD:238011
EGF_CA 549..584 CDD:238011
EGF_CA 586..622 CDD:238011
EGF_CA 626..660 CDD:238011
EGF_CA <734..761 CDD:238011
EGF_CA 803..838 CDD:238011
EGF_CA <848..877 CDD:238011
EGF_CA 930..962 CDD:238011
EGF_CA 965..999 CDD:238011
EGF_CA 1004..1038 CDD:238011
EGF_CA 1040..1078 CDD:238011
Notch 1245..1280 CDD:278494 5/36 (14%)
Notch 1283..1319 CDD:278494 9/59 (15%)
NOD 1329..1375 CDD:284282 12/76 (16%)
NODP 1414..>1453 CDD:284987 6/44 (14%)
Ank_2 <1609..1694 CDD:289560 16/95 (17%)
ANK 1663..1770 CDD:238125 28/132 (21%)
ANK repeat 1664..1694 CDD:293786 9/40 (23%)
Ank_2 1668..1761 CDD:289560 25/118 (21%)
ANK repeat 1696..1728 CDD:293786 7/42 (17%)
ANK 1725..1849 CDD:238125 14/53 (26%)
ANK repeat 1730..1761 CDD:293786 11/36 (31%)
Ank_2 1735..1827 CDD:289560 14/43 (33%)
ANK repeat 1763..1794 CDD:293786 3/10 (30%)
ANK repeat 1796..1827 CDD:293786
ANK repeat 1829..1865 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.