DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and dyl

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_647890.2 Gene:dyl FlyBaseID:FBgn0066365 Length:611 Species:Drosophila melanogaster

Alignment Length:401 Identity:80/402 (20%)
Similarity:128/402 (32%) Gaps:109/402 (27%)


  Fly   344 RVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKD--CLARGSGNGSVLLTLQIGSEVKENR 406
            ::|.|.|:  |.:..|.:.......|.|.|::.....|  |:....|.|.:..|.    |:..|.
  Fly    83 QIKHLQVQ--CEKTHMRVNIEFDRPFYGMIFSKGFYSDPHCVHLKPGTGHLSATF----EIFLNS 141

  Fly   407 CGILRAYEMTQEYQR------------TFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGV 459
            ||      ||.....            :::...::||.:|.||...|:..|:.|...:.... .|
  Fly   142 CG------MTSSANHNAAGYGAPTPSGSYVENTIIIQYDPYVQEVWDQARKLRCTWYDFYEK-AV 199

  Fly   460 SVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETND 524
            :.|...||....| :|..|..:|:....:           ..|..|..|           ..:..
  Fly   200 TFRPFQVDMLHAV-TANFLGDNLQCWMQI-----------QVGKGPWAS-----------EVSGI 241

  Fly   525 VQIGQNLELQIVAEYSPQQLAEHMELQLAPLPDFRATSLVA---KTADNENFVLLIDERGC---P 583
            |:|||.:.:.:..:....:.            |....:.||   |.|.    :.|:|:.||   |
  Fly   242 VKIGQTMTMVLAIKDDENKF------------DMLVRNCVAHDGKRAP----IQLVDQNGCVVRP 290

  Fly   584 TDASVFPALERVHTASRSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNCISSSWQRRRRQA 648
            ...|.|..::....::..:..|.|.||||..:.||.|...|:.|...|....|            
  Fly   291 KIMSKFQKIKNFGPSASVVSFAYFQAFKFPDSMNVHFQCVIQVCRYNCPEPKC------------ 343

  Fly   649 DQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQS-NTNSYLYGERGV 712
                                    .|..........::..|.....:||.:: ..|.:..|..||
  Fly   344 ------------------------GPGLPGGEYGLPQIGANGLSEEYGPPEAYERNDFALGGPGV 384

  Fly   713 LLIAGIDDPLH 723
            |..|...||.|
  Fly   385 LPPAAYPDPRH 395

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532 80/402 (20%)
dylNP_647890.2 ZP 90..345 CDD:214579 64/343 (19%)
Zona_pellucida <236..346 CDD:278526 31/173 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139555381
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.