DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and tyn

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001027032.1 Gene:tyn FlyBaseID:FBgn0284435 Length:715 Species:Drosophila melanogaster

Alignment Length:846 Identity:187/847 (22%)
Similarity:296/847 (35%) Gaps:278/847 (33%)


  Fly    13 LCKLAIAAILLILQLNASVALLLKCPLHQLQLQKIVGFRPPLEYLNADNRIYGPEMVSNFKTRNG 77
            ||.:.:..:.|..|:||.:|           .:|:..|..|      .|..|..:.:|.::    
  Fly    20 LCAVMVVLVTLPEQINARMA-----------FEKLTDFDFP------GNTYYSVKNLSLYE---- 63

  Fly    78 QQELPVSQVCWRICNEDPDCIAYVH------LLDTDECHGYSYFERTSRYLAISGELPLVADGEA 136
                     |...|.|:.||.|...      |..:.|.|  ...:..|     |...|..|...:
  Fly    64 ---------CQGWCREEADCQAAAFSFVVNPLSPSQETH--CQLQNDS-----SAANPSAAPQRS 112

  Fly   137 --VFYE-KTCLRVPDACRGRLWALTKIPG-------STLVYHSKKTISTLVTRRECAERCFFETQ 191
              ::|. |..||..:.|. |.|:..::|.       :.|:|.|        |:..|...|..|.:
  Fly   113 ANMYYMIKLQLRSENVCH-RPWSFERVPNKVIRGLDNALIYTS--------TKEACLSACLNERR 168

  Fly   192 FRCLSASFAPSYRNNRERFRGEAGPGQRPSPRLGRCMLSDRDKT-----VQ-PDAFRAAPYDEEY 250
            |.|.|..:  .|.|.                   :|:|||.|:.     || .||     ...:|
  Fly   169 FVCRSVEY--DYNNM-------------------KCVLSDSDRRSSGQFVQLVDA-----QGTDY 207

  Fly   251 MENQCHERAIESDNCSYELYANSSFIYAE---------ARYLGL-----------SQKECQAMCS 295
            .||.|.:.|....|       |.||..::         |:|:||           |:..|:..|.
  Fly   208 FENLCLKPAQACKN-------NRSFGNSQKMGVSEEKVAQYVGLHYYTDKELQVTSESACRLACE 265

  Fly   296 HEAKFYCQGVSFYYVNQLSLSE--CLL------------------------HSEDI--------- 325
            .|::|.|:  ||.|:.|...|:  |.|                        |.|.|         
  Fly   266 IESEFLCR--SFLYLGQPQGSQYNCRLYHLDHKTLPDGPSTYLNHERPLIDHGEPIGQYFENQCE 328

  Fly   326 ---------------------VSL----GPRSLKLRENSVYMRRV-KCLDVRVFCTRDEMTIKYN 364
                                 |||    .|....|..|.|...:. .|.||.|.|....:.::..
  Fly   329 KAAGLGAGSPPGTLDKIDTLPVSLDTIEDPNLTNLTRNDVNCDKTGTCYDVSVHCKDTRIAVQVR 393

  Fly   365 PKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVV 429
            ....|.|:|||...|:.|......:.:..|.|.:..:    .|   ....:|..|..|     ||
  Fly   394 TNKPFNGRIYALGRSETCNIDVINSDAFRLDLTMAGQ----DC---NTQSVTGVYSNT-----VV 446

  Fly   430 IQNNPNVQTQGDRLIKVGCI--QSNATTSLG-VSVRDSSVDSSEPVPSAIALESSLEYTEHMFPH 491
            :|::..|.|:.|::.||.|.  .|:...:.| :.:||..                          
  Fly   447 LQHHSVVMTKADKIYKVKCTYDMSSKNITFGMMPIRDPE-------------------------- 485

  Fly   492 EGVVHYNSS-TGPHPHPSISLQILDLSHQHETNDVQIGQNLELQI-VAEYSPQQLAEHMELQLAP 554
              ::|.||| ..|.|.    ::||| :.|.|...|:||..|..:| :.|.:|..:.         
  Fly   486 --MIHINSSPEAPPPR----IRILD-TRQREVETVRIGDRLNFRIEIPEDTPYGIF--------- 534

  Fly   555 LPDFRATSLVAKTADNENFVLLIDERGCPTDASVFPALERVHTASRSMLRARFHAFKFSGTANVS 619
                 |.|.||...|......:||:.|||||.::||..    ||..:.|::.:.||:|:.:..|.
  Fly   535 -----ARSCVAMAKDARTSFKIIDDDGCPTDPTIFPGF----TADGNALQSTYEAFRFTESYGVI 590

  Fly   620 FDVKIRFCVERCSPSNC------ISSSWQRRRRQADQPDRRPEDLRVQNPVYISTVVDVAPQPDN 678
            |...:::|:..|.|:.|      ..|..:||||..:..|.:.|                    |:
  Fly   591 FQCNVKYCLGPCEPAVCEWNMDSFESLGRRRRRSIESNDTKSE--------------------DD 635

  Fly   679 FTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAGIDDPLHLDNVCINQSLLIALFIFWLI 743
            ...|||.|.|::........:::.::....::.|.:|........:..:.:..:|:|.|:|..|.
  Fly   636 MNISQEILVLDFGDEKREFFKADPSTDFAKDKTVTIIEPCPTKTSVLALAVTCALMILLYISTLF 700

  Fly   744 C 744
            |
  Fly   701 C 701

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 25/109 (23%)
PAN_AP_HGF 270..344 CDD:238532 30/154 (19%)
tynNP_001027032.1 PAN_4 46..97 CDD:290993 14/72 (19%)
PAN_AP_HGF 131..210 CDD:238532 26/113 (23%)
PAN_1 236..327 CDD:278453 20/93 (22%)
ZP 382..598 CDD:214579 67/279 (24%)
Zona_pellucida <512..605 CDD:278526 32/111 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D200714at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR47327
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.