DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and N

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001245510.1 Gene:N FlyBaseID:FBgn0004647 Length:2703 Species:Drosophila melanogaster

Alignment Length:431 Identity:77/432 (18%)
Similarity:127/432 (29%) Gaps:152/432 (35%)


  Fly   160 IPGSTLVYHSKKTISTLVT----------------RRECAERCFFETQFRCLS----ASFAPSYR 204
            :||.| ..|.:|.:...::                :.|| .|.|::.  .|||    .:..|...
  Fly   704 VPGFT-GQHCEKNVDECISSPCANNGVCIDQVNGYKCEC-PRGFYDA--HCLSDVDECASNPCVN 764

  Fly   205 NNR-----ERFRGEAGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDE----------EYMENQ 254
            ..|     ..|.....||....    ||.|...:.:..|.......||:          .|...:
  Fly   765 EGRCEDGINEFICHCPPGYTGK----RCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQK 825

  Fly   255 CHERAIESDNCSYELYANSSFI------YAEARYLGLSQKECQA--------MCSHEAK------ 299
            |....   |:|......|....      |.....:..:.::|::        .|.:|||      
  Fly   826 CE
TNI---DDCVTNPCGNGGTCIDKVNGYKCVCKVPFTGRDCESKMDPCASNRCKNEAKCTPSSN 887

  Fly   300 ---FYCQ---GVSFYYVNQLSLSECLLHSEDIVSLGPRSLKLRENSVYMRRVKCLDV----RVFC 354
               |.|.   |.:..|.:: .:.||.|                 :|.......||:|    |..|
  Fly   888 FLDFSCTCKLGYTGRYCDE-DIDECSL-----------------SSPCRNGASCLNVPGSYRCLC 934

  Fly   355 TRDEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGS--------------EVKEN 405
            |:.     |..:|       .::::.||.:....||...|. .||.              |...|
  Fly   935 TKG-----YEGRD-------CAINTDDCASFPCQNGGTCLD-GIGDYSCLCVDGFDGKHCETDIN 986

  Fly   406 RCGILRAYEMTQ---------EYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQS---------- 451
            .|       ::|         :|..::.....:..:..|.||..:...:..|:..          
  Fly   987 EC-------LSQPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGINGY 1044

  Fly   452 NATTSLGVS-----VRDSSVDSSEPVPSAIALESSLEYTEH 487
            |.:...|.|     .:.:..||:..:..|...|.:.|||.|
  Fly  1045 NCSCLAGYSGANCQYKLNKCDSNPCLNGATCHEQNNEYTCH 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 24/130 (18%)
PAN_AP_HGF 270..344 CDD:238532 15/100 (15%)
NNP_001245510.1 EGF_CA 179..214 CDD:238011
EGF_CA 217..252 CDD:238011
EGF_CA 260..291 CDD:238011
EGF_CA 295..329 CDD:238011
EGF_CA 331..369 CDD:238011
EGF_CA 449..486 CDD:238011
EGF_CA 488..524 CDD:238011
EGF_CA 526..562 CDD:238011
EGF_CA 564..600 CDD:238011
EGF_CA 602..637 CDD:238011
EGF_CA 640..675 CDD:238011
EGF_CA 677..713 CDD:238011 4/10 (40%)
EGF_CA 715..750 CDD:238011 4/38 (11%)
EGF_CA 753..789 CDD:238011 7/40 (18%)
EGF_CA 791..827 CDD:238011 5/36 (14%)
EGF_CA 829..865 CDD:238011 5/39 (13%)
EGF_CA 907..943 CDD:238011 12/65 (18%)
EGF_CA 946..982 CDD:238011 7/37 (19%)
EGF_CA 984..1020 CDD:238011 5/43 (12%)
EGF_CA 1027..1058 CDD:238011 4/31 (13%)
EGF_CA 1062..1095 CDD:238011 8/25 (32%)
EGF_CA 1184..1219 CDD:238011
EGF_CA 1221..1257 CDD:238011
EGF_CA 1259..1295 CDD:238011
EGF_CA 1297..1335 CDD:238011
EGF_CA 1417..1450 CDD:238011
NL 1476..1512 CDD:197463
Notch 1519..1553 CDD:278494
Notch 1565..1593 CDD:278494
NOD 1599..1648 CDD:284282
NODP 1680..1731 CDD:284987
ANK 1896..2038 CDD:238125
ANK repeat 1902..1948 CDD:293786
ANK repeat 1951..1981 CDD:293786
Ank_5 1970..2025 CDD:290568
ANK 1978..2104 CDD:238125
ANK repeat 1984..2015 CDD:293786
ANK repeat 2017..2048 CDD:293786
Ank_2 2022..2114 CDD:289560
ANK repeat 2050..2081 CDD:293786
ANK repeat 2083..2114 CDD:293786
DUF3454 2627..2682 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.