DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and cutl-17

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_501670.2 Gene:cutl-17 WormBaseID:WBGene00009541 Length:912 Species:Caenorhabditis elegans

Alignment Length:920 Identity:158/921 (17%)
Similarity:297/921 (32%) Gaps:308/921 (33%)


  Fly    47 IVGFRPPLEYLNADNRIYGPEMVSNFKTRNGQ---------QELPVSQVCWRICNEDPDCIAYVH 102
            ::||..|:  |.|.:|...|...:..::...:         :::.::: |...|:..        
 Worm     6 LLGFLVPI--LQASSRCSAPNATTYLRSEGTRLMEFSTKVMKDVTLNE-CANACSNS-------- 59

  Fly   103 LLDTDECHGYSYFERTSRYLAIS---------GELPLVADGEAV-FYEKTCLRVPDACRGRLWAL 157
             |.|:||..:.|   .:..|..|         |...|....:.: |:::.||.....|:.. ::.
 Worm    60 -LSTEECLSFEY---DASILQCSHHSDDGQPFGASVLAKASQTISFFQQICLLEEAVCKAP-YSF 119

  Fly   158 TKIPGSTLVYHSKKTISTLVTRRECAERCFFETQ---FRCLSASFAPSYRNNRERFRGEAGPGQR 219
            .:.|.|.|:.|:.|.: |:....:|..:|....:   |.|.||.:   |...             
 Worm   120 ERYPQSILIGHAMKVL-TVDGLSDCLSKCALSQRSYDFLCKSAIY---YYET------------- 167

  Fly   220 PSPRLGRCMLSDRDKTVQPDAFRAAPYDE--EYMENQCHERAIESDNCSY------ELYANSSFI 276
                 |.|:::..:|.:.|..|:....|.  :|.||.|.:.:.:.:...:      .|...|..:
 Worm   168 -----GECIMNRDNKFIYPKLFKTNILDTLVDYFENNCADVSCKPEETLHWVRTEEYLIDESKDV 227

  Fly   277 YAEARYLGLSQKECQAMCSH----EAKFYCQGVSFYYVNQLSLSECLLHSED--IVSLGPRSLKL 335
            ..|:.    ..:||..:|.:    |..|.|:  :|.|.|  |..||.|.:|.  :...|.:...|
 Worm   228 IVESS----DAQECNQLCQNNKIGEENFPCK--AFAYSN--SKQECHLTAESSYVGHKGDKRFNL 284

  Fly   336 R--ENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQI 398
            .  .:..|..:. ||...:.|......:..|.......|..:::...:||::...:|:       
 Worm   285 APLNSGEYFEKY-CLPTNLQCIEASFELVANRMMTSAYKTISALSQHECLSQCMNDGA------- 341

  Fly   399 GSEVKENRCGILRAYEMTQEYQRTFISAL-----------------------------------V 428
                   ||.....:.|..|.|.:.||..                                   .
 Worm   342 -------RCSSATYFYMDDECQLSDISQFSRPNEFVVANFTDYFDKICDPADPKPMLTTPETPPE 399

  Fly   429 VIQNN-------------------------PNVQTQGDRLIK----VGCIQS-NATTSLG----- 458
            :|||:                         .:|:.:.|.|:|    |..:.. ..||::|     
 Worm   400 LIQNSVDEEETTSERSIAQGAANFEVATTGTSVEFEDDNLLKDNQAVDAVHGVTTTTNIGEKRET 464

  Fly   459 -VSVRDSSV-----------DSSEPVPSAIALES-------------------SLEYTEHMFPHE 492
             |.:.::.:           ||.|..|...:.||                   ||::..   |..
 Worm   465 KVEIEETVIDDADEFSREIDDSHEESPLTSSEESEGRVKARLSTECRMSGISVSLKFAT---PTS 526

  Fly   493 GVV----HYNSSTGPHPHPSIS-LQI-------------------LDLSHQHETNDVQ-----IG 528
            |.:    |::|......:.|.: |.|                   .|.:...|.||::     ..
 Worm   527 GTIYIKDHFSSCRQSFSNTSFAELHIPFPTEDDSKCGGIESEPHKWDYNVVVERNDMKTPSLVTT 591

  Fly   529 QNLELQIVAEYSPQQLAEHMELQLAPLP-----DFRATSLVAKTADNENFV-------------L 575
            ::...|:..::|  ::|:  :.|||.|.     |.::..::.:...|...|             .
 Worm   592 KDKTFQVSCDFS--KIAD--KNQLAALKPKVEGDVKSEKVLMEIVRNGQAVTTVPLGAEVSLRWT 652

  Fly   576 LIDE------------------------------RGCPTDASVFPALERVHTASRSMLRARFHAF 610
            :|||                              :|||.:......|......:..:...:...|
 Worm   653 VIDETDKLGFFINECIAERVGGQPPYPEPLKIIYQGCPEEKVRNRLLHDPVVKNGEVYSTKMKVF 717

  Fly   611 KFSGTANVSFDVKIRFCVERCSPSNCIS------SSWQRRRRQAD-----QPDRRPEDLRVQNPV 664
            :|.|:..|.....|..|||:|.|..|..      .|:.|::|.::     :...:.|..:.:...
 Worm   718 RFDGSRRVRIKCSIDVCVEKCPPVICDDLEIRNVDSFGRKKRNSNVEKWLKAGNKKETRKRRMVT 782

  Fly   665 YISTVVD-------VAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAGIDDPL 722
            ...|:.|       |.|:|:..|.|.......|.:      |.:...:|.....:|::..|...|
 Worm   783 GTLTITDEEETNTTVKPRPEFSTSSSSSSQQQYCV------QKDRIEFLIVIVVLLILLQIGLAL 841

  Fly   723 HLDNVCINQS 732
            .....|:::|
 Worm   842 FFYRKCVSRS 851

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 22/101 (22%)
PAN_AP_HGF 270..344 CDD:238532 19/82 (23%)
cutl-17NP_501670.2 PAN_1 28..106 CDD:278453 12/91 (13%)
PAN_AP_HGF 114..199 CDD:238532 22/108 (20%)
PAN_AP 208..295 CDD:214680 20/95 (21%)
PAN_AP_HGF 308..380 CDD:238532 12/86 (14%)
ZP 509..744 CDD:214579 41/242 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D200714at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
33.070

Return to query results.
Submit another query.