DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and Notch3

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_017172782.1 Gene:Notch3 MGIID:99460 Length:2330 Species:Mus musculus

Alignment Length:353 Identity:78/354 (22%)
Similarity:131/354 (37%) Gaps:91/354 (26%)


  Fly    87 CWRICNE---DPDCIAYVHLLDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYEKTCL---- 144
            |||:.|.   ||.|.:...|.|..:|:.... :||..        |:        |||.|.    
Mouse  1434 CWRLFNNSRCDPACSSPACLYDNFDCYSGGR-DRTCN--------PV--------YEKYCADHFA 1481

  Fly   145 --RVPDACRGR------LWALTKIPGSTLVYHSKKTISTLVTRREC--AERCFFETQFRCLSASF 199
              |....|...      |...:::|  .|:......::.|:...|.  :...|.:.    |||..
Mouse  1482 DGRCDQGCNTEECGWDGLDCASEVP--ALLARGVLVLTVLLPPEELLRSSADFLQR----LSAIL 1540

  Fly   200 APSYRNNRERFRGEA--GPGQRPSP----RLGRCMLSDRDKTVQPDAFRAAPYDEEYMENQCHER 258
            ..|.|...:. ||:|  .|..||||    |:.|        .:.|:...:....|  ::|:...:
Mouse  1541 RTSLRFRLDA-RGQAMVFPYHRPSPGSESRVRR--------ELGPEVIGSVVMLE--IDNRLCLQ 1594

  Fly   259 AIESDNCSYELYANSSFIYAEARYLG-LSQKECQAMCSHEAKFYCQGVSFYYVNQLSLSECLLHS 322
            :.|:|:|..:  |.|:     |.||| ||..|              .:.|.|..:....|.|...
Mouse  1595 SAENDHCFPD--AQSA-----ADYLGALSAVE--------------RLDFPYPLRDVRGEPLEAP 1638

  Fly   323 EDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGKIYASMH-------SK 380
            |..|.|.|   .|...:|::..:..|.|.|...:.|.:..:.|:.:.:.|..|:.|       .:
Mouse  1639 EQSVPLLP---LLVAGAVFLLIIFILGVMVARRKREHSTLWFPEGFALHKDIAAGHKGRREPVGQ 1700

  Fly   381 DCLA-RGSGNGSVLLTLQIGSEVKENRC 407
            |.|. :....|..|:. ::.:::.::.|
Mouse  1701 DALGMKNMAKGESLMG-EVVTDLNDSEC 1727

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 23/104 (22%)
PAN_AP_HGF 270..344 CDD:238532 19/75 (25%)
Notch3XP_017172782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.