DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and Notch1

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_032740.3 Gene:Notch1 MGIID:97363 Length:2531 Species:Mus musculus

Alignment Length:315 Identity:60/316 (19%)
Similarity:90/316 (28%) Gaps:131/316 (41%)


  Fly    39 LHQLQLQKIVGFRPPLEYLNADNRIYGPEMVSNFKTRNGQQEL--PVSQVCWRICNE---DPDCI 98
            :::.|.|...||...|...:.|.....|       .:||.:.|  |.:..|  :|.|   ...|.
Mouse   509 INEFQCQCPKGFNGHLCQYDVDECASTP-------CKNGAKCLDGPNTYTC--VCTEGYTGTHCE 564

  Fly    99 AYVHLLDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYEKTCLRVPDACRGRLWALTKIPGS 163
            ..:...|.|.||..|                 ..||.|.|   |||     |:         ||.
Mouse   565 VDIDECDPDPCHYGS-----------------CKDGVATF---TCL-----CQ---------PGY 595

  Fly   164 TLVYHSKKTISTLVTR-----RECAERCFFETQFRCLSASFAPSYRNNRERFRGEAGPGQRPSPR 223
            | .:|.:..|:...::     ..|.:|   :..:.||.             .:|..||       
Mouse   596 T-GHHCETNINECHSQPCRHGGTCQDR---DNSYLCLC-------------LKGTTGP------- 636

  Fly   224 LGRCMLSDRDKTVQPDAFRAAPYDEEYMENQCHERAIESDNC-----SYELYANSSFIYAEARYL 283
              .|.::..|                     |.....:|..|     .||       ...|..|.
Mouse   637 --NCEINLDD---------------------CASNPCDSGTCLDKIDGYE-------CACEPGYT 671

  Fly   284 G----LSQKECQAMCSHE--------AKFYCQGVSFYY-------VNQLSLSECL 319
            |    ::..||.....|.        |.|.|:....|:       ||:.:.:.|:
Mouse   672 GSMCNVNIDECAGSPCHNGGTCEDGIAGFTCRCPEGYHDPTCLSEVNECNSNPCI 726

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 14/101 (14%)
PAN_AP_HGF 270..344 CDD:238532 13/70 (19%)
Notch1NP_032740.3 EGF_CA 142..175 CDD:238011
EGF_CA 178..216 CDD:238011
EGF_CA 257..293 CDD:238011
EGF_CA 295..332 CDD:238011
EGF_CA 335..370 CDD:238011
EGF_CA 412..450 CDD:238011
Interaction with DLL4. {ECO:0000250|UniProtKB:Q07008} 420..421
Interaction with DLL4. {ECO:0000250|UniProtKB:Q07008} 448..452
EGF_CA 452..488 CDD:238011
EGF_CA 490..526 CDD:238011 5/17 (29%)
EGF_CA 528..564 CDD:238011 10/45 (22%)
EGF_CA 566..601 CDD:238011 17/70 (24%)
EGF_CA 603..639 CDD:238011 9/61 (15%)
EGF_CA 641..675 CDD:238011 9/62 (15%)
EGF_CA 678..713 CDD:238011 7/35 (20%)
EGF_CA 717..750 CDD:238011 3/11 (27%)
EGF_CA 755..789 CDD:238011
EGF_CA 791..827 CDD:238011
EGF_CA 869..905 CDD:238011
EGF_CA 907..943 CDD:238011
EGF_CA 945..981 CDD:238011
EGF_CA 988..1019 CDD:238011
EGF_CA 1021..1057 CDD:238011
EGF_CA 1146..1180 CDD:238011
EGF_CA 1184..1219 CDD:238011
EGF_CA 1221..1265 CDD:238011
EGF_CA 1267..1305 CDD:238011
NL 1442..1479 CDD:197463
LNR 1 1449..1489
Notch 1487..1522 CDD:278494
LNR 2 1490..1531
Notch 1525..1561 CDD:278494
LNR 3 1532..1571
NOD 1567..1618 CDD:284282
NODP 1662..1719 CDD:284987
Interaction with PSEN1. {ECO:0000250|UniProtKB:P46531} 1718..1750
Ank_2 <1863..1948 CDD:289560
ANK repeat 1870..1915 CDD:293786
ANK 1912..2024 CDD:238125
ANK repeat 1917..1948 CDD:293786
ANK 1 1917..1946
Ank_2 1922..2015 CDD:289560
HIF1AN-binding 1937..1945
ANK repeat 1950..1981 CDD:293786
ANK 2 1950..1980
ANK 1979..2103 CDD:238125
ANK repeat 1984..2015 CDD:293786
ANK 3 1984..2013
Ank_2 1989..2081 CDD:289560
HIF1AN-binding 2004..2012
ANK repeat 2017..2081 CDD:293786
ANK 4 2017..2046
ANK 5 2050..2079
DUF3454 2454..2516 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.