DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and cutl-29

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_509395.2 Gene:cutl-29 WormBaseID:WBGene00017421 Length:390 Species:Caenorhabditis elegans

Alignment Length:437 Identity:96/438 (22%)
Similarity:158/438 (36%) Gaps:108/438 (25%)


  Fly   349 DVRVFCTRDEMTIKYNPKDWFVGKIYASMHSK--DCLARGSGNGSVLLTLQIGSEVKENRCGILR 411
            |.:|.||...:.:.......|.|.:......|  .|..:|:|:.|:.:.:.:.:..|   |.:: 
 Worm    22 DKKVTCTSSNIEVALTFAKSFSGGVLTENPRKYEQCRWKGNGSNSMSINIPLFNSTK---CAVV- 82

  Fly   412 AYEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAI 476
            |.|.:..|     |..:::.....:...|...|.|.||.:....:|             .:|...
 Worm    83 ANETSGTY-----SIKLLVSPVDGLIVDGFSAINVKCIYATQDITL-------------TLPPIF 129

  Fly   477 ALESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDV---QIGQNLELQIVAE 538
            ...::|:.|. |.....||     ||....|::::|||: .|....:.|   .:||.:.|.|.  
 Worm   130 NGTNALQITA-MNDDNSVV-----TGSGGSPALTMQILE-GHGISGSPVVKAAVGQRITLDIA-- 185

  Fly   539 YSPQQLAEHMELQLAPLPDFRATSLVAKTADN--ENFVLLIDERGCP---TDASVFPALERVHTA 598
                       ||...:.||...|..|....|  :..:.:||..||.   :.|...||:....|.
 Worm   186 -----------LQNTAIYDFYVHSCYAHDGSNSPDASINIIDSNGCGVRLSRAIDVPAMSAQPTP 239

  Fly   599 SRSMLRARFHAFKFSGTAN--VSFDVKIRFCVERCSPSNCISS---------SWQRRRRQADQPD 652
            : .......|.:.|..|:|  |.|:.:::.|::.|....||..         :.:|||.:.:..|
 Worm   240 N-GPKHVYLHMYGFQFTSNNFVHFECQVKPCIKSCHREQCIREPDTKIPVIPAHRRRRHEDNSTD 303

  Fly   653 RRPEDLRVQNPVYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLLIAG 717
              ...||::      ||::::||.   |.|...|       |...|.:.                
 Worm   304 --VATLRLE------TVLEISPQS---TLSAAAL-------VSSEDYAR---------------- 334

  Fly   718 IDDPLHLDNVCINQSLLIALFIFWLICQVALLFGCGMVLQRYRRLAK 764
               |.|    |.:|..|||...|..:....|:   .||...|||..|
 Worm   335 ---PAH----CYSQPALIATCTFVFVITALLV---SMVHVVYRRWTK 371

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
cutl-29NP_509395.2 ZP 26..278 CDD:214579 62/295 (21%)
Zona_pellucida <166..275 CDD:278526 28/123 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C139554847
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.