DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and cutl-18

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_505875.2 Gene:cutl-18 WormBaseID:WBGene00009830 Length:801 Species:Caenorhabditis elegans

Alignment Length:899 Identity:161/900 (18%)
Similarity:277/900 (31%) Gaps:363/900 (40%)


  Fly    61 NRIYGPEMVSNFKTRNGQQELPVS-QVCWRICNEDPDCIAYVHLLDTDEC---HGYSYFERTSRY 121
            |...|.:.|:.|.  ||..:||.| ..|:..|... :|...  |...|:|   ...:||.|..  
 Worm    26 NGCQGKDTVAFFV--NGDAKLPASATACFNSCALG-NCTGV--LFQGDKCIVIDKSNYFGRIE-- 83

  Fly   122 LAISGELPLVADGEAVFYEKTCL-RVPDACRGRLWALTKIPGSTLVYHSKKTISTLVTRRECAER 185
                         |..:.||.|: :.|.....:.|      ...::....:::....|:.||...
 Worm    84 -------------ERNYIEKKCVKKAPHRLLVKEW------DDRILVDKSQSVLKAETKLECLSL 129

  Fly   186 CFFETQFRCLSASFAPSYRNNRE------------------------------------------ 208
            |..|.:|.||||.|   ||::::                                          
 Worm   130 CAQEKRFPCLSAMF---YRDSKDCLLNSASSSSAKLKMDTGGFKVSYMELHGLKEAVHCLNAFKM 191

  Fly   209 ------RFRGEA----GPGQRPSPRLGRCM--LSDRDKTVQPDAF-------------------- 241
                  ..|||:    |     |..||:||  ..|.|..:..:.|                    
 Worm   192 VAFDAIEIRGESRIFNG-----SDGLGKCMEKCKDCDVVMYNEGFSECYSVWNDPSGQLLDFVND 251

  Fly   242 ------RAAPYD-----------------EEYMENQCHERAIESDNCSY---------------- 267
                  .|..|.                 :|.::::|.|:...|:.|.:                
 Worm   252 EYQILTNACSYQKKTCNSRNSLYISYSNPDESLKSECLEKCTMSEECRFAYQSKDMNNCLISRRR 316

  Fly   268 ---------------ELYANSSFIYAEARYLG-------------LSQKECQAMCSHEAKFYCQG 304
                           :|...|:.::.|   ||             |...:|..:|:......|:.
 Worm   317 MALPMLAQKICADVNDLSDGSAILFDE---LGGCKNENGQLISKDLELHQCMQLCATHPTRSCES 378

  Fly   305 VSFYYVNQLSLSECLLHSEDIVS--------------------LGPRSL---------------- 333
            :|:     ....:|.||...:.:                    |.|.::                
 Worm   379 ISY-----TKSRDCYLHDGAVETDNENTNCSVFTLNVITFEQELKPTTIAPGDSKVKKPHKAKTF 438

  Fly   334 ---------KLRENSVYMRR-----VKCLDVRVF--CTRDEMTIKYNP-----KDWFVGKIYASM 377
                     |:.|..:|:::     ...|||::.  ||...:::|.:|     .:...|:||...
 Worm   439 STGNKKDQKKVEERKLYVKKSSKLGSSPLDVKISTQCTFGFISVKVSPGNPDNHNLVGGEIYVRN 503

  Fly   378 HSKDCLARGSGNGSVLLTLQIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQN-----NPNVQ 437
            ...:|......:|..:|.::........:.|.:  ||          :.:||.||     |..|.
 Worm   504 GHSNCSKTIGTDGEAILKIRHNDTTCITKNGDI--YE----------TVVVVTQNVESVGNATVI 556

  Fly   438 TQGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAIALESSLEYTE-HMFPHEGVVHYNSST 501
            |..|:|.||.|..||...::                 |:|...:|..|: :.....|.|:..   
 Worm   557 TIDDQLFKVRCDYSNQKNAV-----------------AVAKTMNLRTTQFNKLDIYGKVNVK--- 601

  Fly   502 GPHPHPSISLQILDLSHQHETNDVQIGQNLELQIVAEYSPQQLAEHMELQLAPLPDFRATSLVAK 566
                  .:|:::.......:...|::||:|:|....:.|..  |.|:.::          ...|.
 Worm   602 ------PMSMELRGKREIIKARTVKLGQSLDLVFTVDNSTS--ARHVFVK----------KCTAY 648

  Fly   567 TADNENFVLLIDERGCPTD-ASVFPALERV-HTASRSMLRARFHAFKFSGTANVSFDVKIRFCVE 629
            ..:.:..::|| :.||.|. |..:...:.: .||:..:|  .|.||:|.....|..:.::::| |
 Worm   649 DQNGDEKIILI-KNGCATQHAKEYVLRDEIKETATGFVL--PFRAFRFKQGEAVKIECEVKYC-E 709

  Fly   630 RCSPSNCISSSWQRRRRQADQPDRRPEDLRVQNPVYISTVVDVAPQPDNFTR--SQEELPLNYN- 691
            :|..:||.|    |.||                                ||.  ..|:..|..| 
 Worm   710 KCKKANCPS----RNRR--------------------------------FTTFDESEDTTLTGNE 738

  Fly   692 --IRVHGPDQSNTNSYLYGERGVLLIAGIDDPLHLDNVCINQSLLIALFIFWLI 743
              .:||..               ||:..|.|...||..|:..:..|||....:|
 Worm   739 DTEKVHAE---------------LLVQTIVDSTQLDGYCLQLNRWIALISLTVI 777

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 28/193 (15%)
PAN_AP_HGF 270..344 CDD:238532 17/132 (13%)
cutl-18NP_505875.2 PAN_AP_HGF 105..177 CDD:238532 14/81 (17%)
PAN_AP 187..258 CDD:214680 12/76 (16%)
ZP 474..719 CDD:214579 63/303 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
22.060

Return to query results.
Submit another query.