DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and mec-9

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001256153.1 Gene:mec-9 WormBaseID:WBGene00003173 Length:838 Species:Caenorhabditis elegans

Alignment Length:374 Identity:74/375 (20%)
Similarity:110/375 (29%) Gaps:160/375 (43%)


  Fly    73 KTRNGQQELPVSQVCWRICNEDPDCIAYVHLLDTDE--C------HGYSYFERTSRYLAISGELP 129
            |.|...::..|.|..:::.|  |..:..:.|||.|:  |      |.:.:|.:.      |||. 
 Worm    73 KNRFSSKQQCVKQCKYKMFN--PVAVPDLCLLDADQGHCGDERNGHWWYFFNQE------SGEC- 128

  Fly   130 LVADGEAVFYEKTCLRVPDACRGRLWALTKIPGSTLVYHSKKTISTLVTRRECAERCFFETQFRC 194
                 |..||.        .|.|               :..|..|..:.|:.|.||  ...|..|
 Worm   129 -----EKFFYY--------GCGG---------------NDNKFYSLHMCRKVCGER--LSPQIAC 163

  Fly   195 ----LSASFAPSYRNNRERFRGEAGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDEEYMENQC 255
                |..||..|  |::..:..|...|                                |.:||.
 Worm   164 DHCDLRTSFCKS--NSKFNYTCECRSG--------------------------------YEKNQY 194

  Fly   256 HERAIESDNCSYELYANSSFIYAEARYLGLSQKECQAMCSHEAKFYCQGVSFYYVNQLSLSECLL 320
            .| .|:.|.|                      :..:|:|...|  :|       ||::...:|..
 Worm   195 GE-CIDIDEC----------------------RGYKAVCDRNA--WC-------VNEIGSYKCEC 227

  Fly   321 HSE--------DIVSLGPRSLKLRENSVY---MRRV------------KCLDVRVFCTRDEMTIK 362
            .:.        ..|.||..|:..::.|::   |..|            .|.||.....|.||..|
 Worm   228 MASYRGDGKHCTYVGLGRSSIDCKDCSMHATCMNGVCQCKEGYEGDGFNCTDVNECLRRPEMCNK 292

  Fly   363 ----YNPKDWFVGKIYASMHSKDCLARGSGNGSVLLTLQIGSEVKENRC 407
                .|.:..|:         ..||...:|||       ....|.:|.|
 Worm   293 NAECINREGSFI---------CTCLEGYAGNG-------YNCTVSKNSC 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 18/100 (18%)
PAN_AP_HGF 270..344 CDD:238532 13/85 (15%)
mec-9NP_001256153.1 Kunitz_BPTI 35..87 CDD:278443 4/14 (29%)
Kunitz_BPTI 100..154 CDD:278443 19/89 (21%)
EGF_CA 199..238 CDD:284955 9/70 (13%)
EGF_3 283..318 CDD:289699 11/51 (22%)
KU 323..381 CDD:197529 2/4 (50%)
KU <408..449 CDD:197529
KU 460..516 CDD:197529
EGF_CA 550..586 CDD:238011
EGF 639..671 CDD:278437
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.