DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and cutl-26

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_741299.2 Gene:cutl-26 WormBaseID:WBGene00021950 Length:502 Species:Caenorhabditis elegans

Alignment Length:473 Identity:93/474 (20%)
Similarity:157/474 (33%) Gaps:134/474 (28%)


  Fly   349 DVRVFCTRDEMTIKYNPKDWFVGKIYA-SMHSKDCLARGSGNGSVLLTLQIGSEVKENRCGILRA 412
            |||..|:.|.:::.......|.|.:.. |..|:.|..:|.|....:|.|.:    |.:.|||  .
 Worm    28 DVRWSCSEDVVSVFIRTSKPFEGLVQTRSSESEACRVQGFGTNVAVLKLNL----KSDECGI--K 86

  Fly   413 YEMTQEYQRTFISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLGVSVRDSSVDSSEPVPSAIA 477
            |::.   .:|: |..|.:.::|.:..:||:.:.|.|.:                         ||
 Worm    87 YDVA---SKTY-SVTVDVHSHPVLIVEGDKSVNVTCRE-------------------------IA 122

  Fly   478 LESSLEYTEHMFPHEGVVHYNSSTGPHPHPSISLQILDLSHQHETNDVQIGQNLELQIVAEYSPQ 542
                          .|..||.|..                 ..:::|.|      |::::...|.
 Worm   123 --------------NGTQHYASQM-----------------TSQSSDYQ------LRVLSSRLPV 150

  Fly   543 QLAEHME---LQLAPLPDFRATS-------LVAKTADNENFVLLIDERGCPTDASV---FPALER 594
            ...::.:   ||:.|||..:..|       .:|:.......|.|.|..||....|:   |...|.
 Worm   151 DTVKYSQPYTLQIRPLPSTQQNSYSFFVGQCIAQPVGGNVTVQLTDPVGCALFKSIMGHFARRES 215

  Fly   595 VHTASRSMLRARFHAFKFSGTANVSFDVKIRFCVERCSPSNC-----ISSSWQRRRRQADQPDRR 654
            |..|....:      |:|.....:.....:..|...|....|     .||..:|....|:..:.:
 Worm   216 VEEAEIPSM------FRFPNAKQLKISCIVTECDGSCEARTCDQDSSASSLLERTTASAESEEFQ 274

  Fly   655 PEDLRV-----QNPVYISTVVDVAPQPDNFTRSQEELPLNYNIRVHGPDQSNTNSYLYGERGVLL 714
            ...:.|     ..|| ::..||......:..|..|..|.|                      :::
 Worm   275 RVSIIVNLEEADLPV-LAEAVDEPVMVHHVARDAETPPPN----------------------LIV 316

  Fly   715 IAGIDDPLHLDNVCINQ-SLLIALFIFWLICQ-VALLFGCGMVLQRYRRLAKLEDERRRLHEEYL 777
            ....|:....:.|.:|: :||..|.||..:|. |.......:.|...||.|| :.:|..:..|.|
 Worm   317 QKSRDEIYQTECVSVNEFNLLYYLCIFLAVCSIVGFTMNIVLALMLKRRSAK-KSKRHSIPVEQL 380

  Fly   778 E------ARRVHWADQGG 789
            :      |....|..:.|
 Worm   381 QIPKSSVAPPDFWITENG 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
cutl-26NP_741299.2 ZP 33..252 CDD:214579 56/297 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR47327
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.