DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and glp-1

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_499014.1 Gene:glp-1 WormBaseID:WBGene00001609 Length:1295 Species:Caenorhabditis elegans

Alignment Length:602 Identity:121/603 (20%)
Similarity:199/603 (33%) Gaps:149/603 (25%)


  Fly     1 MPPLQSLVTAPR---------LCKLAIAAILLILQLNASVA-LLLKCPLHQLQLQKIVG---FRP 52
            :|..:::|..|:         ..::.:.|.:..|.....|| ::.|....:.:.:|:|.   :.|
 Worm   742 LPITEAMVAVPKRNEIDEGWSRSQVILFACIAFLAFGTVVAGVIAKNGPERSRKRKMVNATVWMP 806

  Fly    53 PLEYLNADNRIYGPEMVSNFKTRNGQQELPVSQVCWRICNEDPDCIAYVHLLDTDECHGYSYFER 117
            |:|..|...|            ||....   |..|..:.|.     ||.|......|..||....
 Worm   807 PMESTNEKGR------------RNQSNH---SSQCSLLDNS-----AYYHPNTKRHCSDYSTGYN 851

  Fly   118 TSRYLAI-------------------------------SGELPL---VADGEAV---FYEKTCLR 145
            ..:|..|                               :.|:||   .|..:|:   ...::..:
 Worm   852 GEQYSQIYPQTLANGYPGDYNELNFDFQSETFAPADLPADEIPLHVQAAGPDAITAPITNESVNQ 916

  Fly   146 VPDACRGRL--WALTKIPGSTLVYHSKKTISTL-----VTRRECAERCFFETQFRC--------- 194
            |....|.|:  |....:.|......:.:.|..|     |..|:|.|........|.         
 Worm   917 VDSKYRRRVLHWLAANVRGKPEDVITTEAIRCLKAGADVNARDCDENTALMLAVRAHRVRLSVVL 981

  Fly   195 LSASFAPSYRNNRERFR-GEAGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDEEYMENQCHER 258
            |.....|:..||.||.. .||...:  ..|:.|.:|:|:....:.|                   
 Worm   982 LREGANPTIFNNSERSALHEAVVNK--DLRILRHLLTDKRLLKEID------------------- 1025

  Fly   259 AIESDNCSYELYANS-SFIYAEARYLGLSQKE-CQAMCSHEAKFYCQGV----SFYYVNQLSLSE 317
                     ||..|. :.:...||.||..|.| .:.:.|..||....|.    |..|..:.:|..
 Worm  1026 ---------ELDRNGMTALMLVARELGKHQVEMAELLLSKGAKLDYDGAARKDSNKYKGRTALHY 1081

  Fly   318 CLLH--SEDIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNP-KDWFVGKIYASMHS 379
            ..:|  .|.::.|..||....:.....|....|..:..|   |.|::|.. .|..:|.:.:...:
 Worm  1082 AAMHDNEEMVIMLVRRSSNKDKQDEDGRTPIMLAAKEGC---EKTVQYLALNDASLGIVDSMDMT 1143

  Fly   380 KDCLARGSGNGSVLLTL-QIGSEVKENRCGILRAYEMTQEYQRTFISALVVIQNNPNVQTQGDRL 443
            ...:|..|.:..:...| |:.:|  .:|..|:|     |:..::...|....|...|::..|.|.
 Worm  1144 AAQVAEASYHHELAAFLRQVANE--RHRNDIMR-----QQIVKSGHGAKSGRQTVKNIKRAGSRK 1201

  Fly   444 IKVGCIQSNATTSLGVSVRDSSVDSSEP--VPSAIALESSLEYT-EHMFPHEGVVHYNSS--TGP 503
            .......|..|..|.....|.|..|..|  .|:..:..:.:|.: |:||.||.....|:.  |.|
 Worm  1202 TPTSAASSRETNHLTPPPSDGSFSSPSPHYYPTTTSTPNRMETSPEYMFNHEMAPPVNAMWYTTP 1266

  Fly   504 HPHPSISLQILDLSHQH 520
            .|:.       |.:::|
 Worm  1267 PPYQ-------DPNYRH 1276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 21/111 (19%)
PAN_AP_HGF 270..344 CDD:238532 20/82 (24%)
glp-1NP_499014.1 EGF_CA 118..152 CDD:238011
EGF_CA 155..190 CDD:238011
EGF_CA 232..269 CDD:238011
EGF_CA 369..406 CDD:238011
EGF_CA 451..479 CDD:238011
NL 489..526 CDD:197463
Notch 533..568 CDD:278494
Notch 573..608 CDD:278494
NOD 612..661 CDD:284282
NODP 698..755 CDD:284987 3/13 (23%)
ANK repeat 921..959 CDD:293786 8/38 (21%)
ANK 926..1054 CDD:238125 31/158 (20%)
Ank_5 949..1002 CDD:290568 13/53 (25%)
ANK 956..1127 CDD:238125 44/204 (22%)
ANK repeat 961..992 CDD:293786 4/31 (13%)
ANK repeat 994..1028 CDD:293786 11/64 (17%)
Ank_2 999..1105 CDD:289560 28/136 (21%)
ANK repeat 1030..1061 CDD:293786 10/31 (32%)
ANK repeat 1071..1105 CDD:293786 7/34 (21%)
Ank_2 1079..1171 CDD:289560 20/97 (21%)
ANK repeat 1107..1138 CDD:293786 8/34 (24%)
ANK repeat 1140..1170 CDD:293786 6/32 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.