DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and LOC101734729

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_017948621.1 Gene:LOC101734729 ID: Length:502 Species:Xenopus tropicalis

Alignment Length:456 Identity:80/457 (18%)
Similarity:136/457 (30%) Gaps:179/457 (39%)


  Fly   164 TLVYHSKKTISTLVTRRECAERCFFETQFRCLSASFA----------------PSYRNNRERFRG 212
            ::|.||.:      .|....:|..|.|....|.|.:.                ||:..:..|.: 
 Frog    51 SIVLHSNR------LRFALPDRISFTTDLMLLDAHWVLGESPLWTPWTRGWRDPSHTLSLSRRK- 108

  Fly   213 EAGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDE--EYMENQCHERAIESDNCSYELYANSSF 275
               |.....|:||   |......||..|..|:...:  ||:|    :|.:....|    .|....
 Frog   109 ---PTFHCGPKLG---LPGHPVLVQEAASLASQIQDAKEYIE----KRPLRQHRC----LATQDT 159

  Fly   276 IYAEARYLG-------LSQKECQAMCS--------------HEAKFYC----------QGVSFYY 309
            :...|.:.|       ..:..|:.||:              |.:: .|          .||:...
 Frog   160 LVTSAVHRGDISAPSPCGEYGCELMCNDGGCELMCNDGGCEHVSR-VCPVGFQMAETLNGVTCTD 223

  Fly   310 VNQLSLSEC---LLHSED--IVSLGPRSLKLRENSVYMRRVKCLDV------------RVFCTRD 357
            :::...|.|   .:::|.  :...|| .:||..:     |..|.|:            :.||...
 Frog   224 IDECEASSCEGTCINTEGGFVCDCGP-GMKLSTD-----RTSCYDINECRRPGTSHLCKHFCHNT 282

  Fly   358 EMTIKYNPKDWFVGKIYASMHS--------------KDCLARGSGNGSVLLTLQIGSEVKENRCG 408
            .            |..:.|..:              .:||       .......:||.|  |..|
 Frog   283 H------------GSFFCSCRAGFLLDPDKVSCIDVDECL-------DYATICPLGSCV--NTLG 326

  Fly   409 ILRAYEMTQEYQRT---------------FISALVVIQNNPNVQTQGDRLIKVGCIQSNATTSLG 458
            .....|:....|.|               |....|:.|.:.::.|.|.|.::       .:|.|.
 Frog   327 SYFCAEIPAGLQTTGLPWETQAAHGNWMPFQPTSVMPQTSESLTTGGLRPLR-------TSTELA 384

  Fly   459 VSVRDSSVDSSEPVPSAIALESSLEYTEHMFPHEGVVHYNSSTGPHP------HPSISLQILDLS 517
            ..:..::..|        |.:|:|.              |::..|||      ||.::.:...:|
 Frog   385 QGIFCTTTTS--------APQSTLA--------------NANIIPHPQHLRIGHPPLAQKASGIS 427

  Fly   518 H 518
            |
 Frog   428 H 428

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 24/109 (22%)
PAN_AP_HGF 270..344 CDD:238532 17/110 (15%)
LOC101734729XP_017948621.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.