DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and NOTCH2NLC

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:NP_001350942.1 Gene:NOTCH2NLC HGNCID:53924 Length:293 Species:Homo sapiens

Alignment Length:117 Identity:25/118 (21%)
Similarity:35/118 (30%) Gaps:36/118 (31%)


  Fly   212 GEAGPGQ----RPSPR-LGRCMLSD---RDKTVQPDAFRAAPYD----------------EEYME 252
            |..|.|.    ||:|. .|||..|.   |...:..|.:.....:                |.::.
Human    13 GGGGGGDREDARPAPLCCGRCWRSGCAARPPRMCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLG 77

  Fly   253 NQCHERAIESDNCSYELYANSSFIYAEARY--------LGLSQKECQAMCSH 296
            ..|..|    |.|......|.....|:|..        .|.:.::||...||
Human    78 EYCQHR----DPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSH 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 13/67 (19%)
PAN_AP_HGF 270..344 CDD:238532 8/36 (22%)
NOTCH2NLCNP_001350942.1 EGF_CA 200..236 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.