DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and LOC100497309

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_017949619.1 Gene:LOC100497309 ID: Length:666 Species:Xenopus tropicalis

Alignment Length:486 Identity:92/487 (19%)
Similarity:141/487 (29%) Gaps:160/487 (33%)


  Fly    76 NGQQELPVSQVCWRICNEDPDCIAYVHLLDTDECHGYSYFERTSRYLAISGELPLVADGEAVFYE 140
            :|...:||.|||  .|.....| .|..|::       :|.|  .:|..:....|   ||   |..
 Frog   252 SGSIFVPVVQVC--NCTNGGTC-DYNSLIE-------NYQE--PKYQVVGCTCP---DG---FSG 298

  Fly   141 KTCLRVPDACRGRLWALTKIPGSTLVYHSKKTIST----LVTRRECAERCFF------------E 189
            ..|......|||.. ....:|.:|....|:....|    .|......|:||.            .
 Frog   299 AFCQNPSSPCRGEP-CFPSVPCTTPTSKSRFVCGTCPPGTVASGADGEKCFLNDLCLPPYPFPCR 362

  Fly   190 TQFRCLSA--SFA----PSYRNNRERFRGEAGPGQRPSPRLGRCMLSDRDKTVQPDAFRAAPYDE 248
            ...:|:|:  ||:    |.:..|                 ...|...|..:|:.     |.|   
 Frog   363 ENAKCISSFGSFSCLCKPGFTGN-----------------ANNCSDIDECQTIS-----ACP--- 402

  Fly   249 EYMENQCHERAIESDNCSYELYANSSFIYAEARYLGLSQKECQAMCSHEAKFYCQGVSFYYV--- 310
                           |..||...:........||...|..|| ...|:...:.....:..::   
 Frog   403 ---------------NAKYECINSPGSFTCACRYQSTSDAEC-GDSSNPPGWNIFNCTLKWLALD 451

  Fly   311 ---NQLSLSECLLHSE---DIVSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWF 369
               |.||.|......|   .|:|||      .:|..|..::|...:....:...:.:..:...||
 Frog   452 VPGNNLSPSSSAKQYEKLQSILSLG------FQNKFYSLQLKNSSIGGAFSEYRINVSSDTPHWF 510

  Fly   370 VGKIYASMHSKDCLARGSGNGSVLLTLQIGS---------EVKENRCGILRAYEMTQEYQRTFIS 425
            |         ||.|.|      |....|.|:         :..|:.|      ..|...:.|:..
 Frog   511 V---------KDYLIR------VHNYYQFGTVWVEDVNECDENEHNC------SATAMCKNTYGG 554

  Fly   426 ALVVIQNN---------PNVQTQGDRLIKVGCIQSNA---TTSLGVSV----------------- 461
            ...|...|         ||.::|...|.....::.:.   ...||..:                 
 Frog   555 YKCVCDQNMKLEAYDCVPNDKSQNQTLTSSSSMEQDTMILALVLGFGIPLVILLLLLICCYCSRR 619

  Fly   462 RDSSVDSSEPVPSAIALESSLE---YTEHMF 489
            :|...:.:.| |..:|.|:...   |.|.||
 Frog   620 KDGQANIAAP-PDIMAAENCWAPNVYAEPMF 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 19/118 (16%)
PAN_AP_HGF 270..344 CDD:238532 17/83 (20%)
LOC100497309XP_017949619.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.