DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and notch2

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_002939126.2 Gene:notch2 XenbaseID:XB-GENE-6046917 Length:2455 Species:Xenopus tropicalis

Alignment Length:439 Identity:82/440 (19%)
Similarity:157/440 (36%) Gaps:138/440 (31%)


  Fly   238 PDAFRAAPYDEEYMENQC--HERAIESDNCSYEL---YAN-SSFIYAEARYLGLSQK-------- 288
            ||..|     :.|.:.:|  ||...:..:||..:   :|| ||.:.....:.|...:        
 Frog  1432 PDKAR-----DGYCDQECNTHECLWDGGDCS
LTMEDPWANCSSSLKCWEYFNGQCDELCNTPECL 1491

  Fly   289 ----ECQ---AMCSHEAKFYCQGVSFYYVN-----QLSLSEC----LLHSED------------I 325
                |||   ::|.::.  ||:.   :|.|     ..:..||    |..|.|            :
 Frog  1492 FDNFECQEKESICKYDK--YCED---HYANGHCDKSCNTKECGWDGLDCSTDKPENLAEGTLVIV 1551

  Fly   326 VSLGPRSLKLRENSVYMRRVKCLDVRVFCTRDEMTIKYNPKDWFVGK--IYASMHSKDCLARGSG 388
            |.:.|:.| |:.:..::|.:..:      .|..:.||.||.    |.  ::.....|....|...
 Frog  1552 VLMPPKEL-LKNSRNFLRELGSI------LRTNLRIKRNPD----GSPMVFPYFREKSSAQRSRR 1605

  Fly   389 NGSVLLTLQIGSEVKENRCGILRAYEM--------TQEYQRTFISALVVIQNNPNVQTQGDRLIK 445
            :   ||.|::..|::|...|...:.|:        :.:..:|..||..::..:....|....|:.
 Frog  1606 S---LLELRVVRELEEQPIGSKVSLEIDNQQCVLDSDQCFKTTDSAAAMLAAHAVQGTLNYPLVS 1667

  Fly   446 VGCIQSNATTSLGVSVRDSSVDSSE------PVPSAIAL----------ESSLEYTEHMFPHEGV 494
            ||.              :.:..||:      ||..||.:          :...::....||...:
 Frog  1668 VGV--------------EKAPPSSQTLMYILPVILAIIIVILLLVVVLAKKKRKHGTLWFPEGFL 1718

  Fly   495 VHYNSSTGPHPHP---------SISLQILD------LSHQHETND--------VQIGQNL----E 532
            :|.::|......|         ::|:.|:|      ..:.|.::|        ...||.|    :
 Frog  1719 LHRDTSNQKRREPVGQDAVGMKNLSVPIVDGNLLDSNQNDHWSDDRGPQPKKSKSEGQALLSGGD 1783

  Fly   533 LQIVAEYSPQQLAEHMELQLAPLPDFRATSLVAKTADNENFVLLIDERG 581
            .|:.:....||.....::::.|     :.:|....|:.:..|:.::.||
 Frog  1784 DQVDSRQWTQQHLVAADIRMTP-----SLALTPPQAEQDMDVIDVNVRG 1827

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 4/17 (24%)
PAN_AP_HGF 270..344 CDD:238532 23/111 (21%)
notch2XP_002939126.2 EGF_CA 141..176 CDD:238011
EGF_CA 178..215 CDD:238011
EGF_CA 256..292 CDD:238011
EGF_CA 294..331 CDD:238011
EGF_CA 334..369 CDD:238011
EGF_CA 411..450 CDD:238011
EGF_CA 452..488 CDD:238011
EGF_CA 491..526 CDD:238011
EGF_CA 528..564 CDD:238011
EGF_CA 604..639 CDD:238011
EGF_CA 641..676 CDD:238011
EGF_CA 678..713 CDD:238011
EGF_CA 717..751 CDD:238011
EGF_CA 753..789 CDD:238011
EGF_CA 791..827 CDD:238011
EGF_CA 869..905 CDD:238011
EGF_CA 907..943 CDD:238011
EGF_CA 945..980 CDD:238011
EGF_CA 983..1018 CDD:238011
EGF_CA 1022..1057 CDD:238011
EGF_CA 1147..1181 CDD:238011
EGF_CA 1184..1219 CDD:238011
EGF_CA 1221..1261 CDD:238011
EGF_CA 1263..1301 CDD:238011
EGF_CA <1311..1342 CDD:238011
Notch 1426..1457 CDD:278494 8/30 (27%)
Notch 1464..1498 CDD:278494 7/34 (21%)
Notch 1504..1536 CDD:278494 8/37 (22%)
NOD 1541..1592 CDD:284282 11/62 (18%)
NODP 1621..1676 CDD:284987 9/69 (13%)
ANKYR <1821..1933 CDD:223738 2/8 (25%)
ANK repeat 1829..1876 CDD:293786
ANK 1874..1999 CDD:238125
ANK repeat 1879..1909 CDD:293786
Ank_2 1883..1976 CDD:289560
ANK repeat 1911..1976 CDD:293786
ANK 1940..2064 CDD:238125
Ank_2 1950..2042 CDD:289560
ANK repeat 1978..2009 CDD:293786
ANK repeat 2011..2042 CDD:293786
DUF3454 2371..2431 CDD:288764
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.