DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and LOC100330861

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_002665476.3 Gene:LOC100330861 ID: Length:435 Species:Danio rerio

Alignment Length:357 Identity:79/358 (22%)
Similarity:113/358 (32%) Gaps:106/358 (30%)


  Fly     4 LQSLVTAPRLCKLAIAAILLILQLNASVALL----LKCPLHQLQLQKIVGFRPPLEYL-NADNRI 63
            ||||.|..:...|...:   ::||.|....|    |..|.|..:|.|::.......:| :|...:
Zfish    50 LQSLRTLKKKLSLLQDS---VVQLPAKPRNLTCPALDTPAHGRKLGKVLFPGHEAHFLCDAGYEL 111

  Fly    64 YGPEMVSNFKTR--------NGQQELPVSQVCWRICNEDPDCIAYVHL---LDTDECHGYSYF-- 115
            .|.|      ||        :|||.         :|.|..:|::....   ..|||.:|:|..  
Zfish   112 LGSE------TRQCRDSLSWSGQQP---------VCREIDECLSSPCANAGTCTDEVNGFSCVCP 161

  Fly   116 ---------ERTSRYLAISGELPLVADGEAVFYEKTCLRVPD----ACRGRLWALTKIPGSTLVY 167
                     ..|..:|......|.|....|......|..|..    :|.         ||.::  
Zfish   162 KGWAGPACQSPTPTFLVTVMNSPAVTAAPAFTRPARCSAVQGTTVCSCE---------PGFSV-- 215

  Fly   168 HSKKTISTLVTRREC-------AERCFFET------QFRCLSASFAPSYRNNRERFRGEAGPGQR 219
             |.:..|......||       |.|....|      .:||   |....|...|:           
Zfish   216 -SGRDSSVCTDIDECKLFHNGPAGRLCLHTCVNTAGGYRC---SCPAGYNLTRD----------- 265

  Fly   220 PSPRLGR-CMLSDRDKTVQPDAFRAAPYDEEYMENQCHERAIESDNCSYELYANSSFIYAEARYL 283
                 || |...|...:.|.|..|.......|...||.:  :|..|.....||.:|.:..|....
Zfish   266 -----GRNCKDIDECSSRQNDCTREQICVNTYGGFQCVK--VECPNTRDATYAKTSAVRCERNPC 323

  Fly   284 GLSQKEC-QAMCSHEAKFYCQGVSFYYVNQLS 314
            ....:.| ||..|         |||:|::.:|
Zfish   324 PAGSRSCSQAPNS---------VSFHYLSLVS 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453 23/110 (21%)
PAN_AP_HGF 270..344 CDD:238532 13/47 (28%)
LOC100330861XP_002665476.3 CCP 79..133 CDD:153056 15/69 (22%)
EGF_CA 135..170 CDD:238011 6/35 (17%)
EGF_CA 225..270 CDD:214542 13/64 (20%)
EGF_CA 271..>298 CDD:304395 7/27 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.