DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17111 and si:ch73-281k2.5

Sequence 1:NP_651119.2 Gene:CG17111 FlyBaseID:FBgn0039048 Length:792 Species:Drosophila melanogaster
Sequence 2:XP_009302182.1 Gene:si:ch73-281k2.5 ZFINID:ZDB-GENE-141222-10 Length:256 Species:Danio rerio

Alignment Length:61 Identity:18/62 (29%)
Similarity:25/62 (40%) Gaps:9/62 (15%)


  Fly   680 TRSQEELPLNYNIRVHGPDQSNT-NSY----LYGERGVLLIAGIDD----PLHLDNVCINQ 731
            |...:|..|..|...:|...||| |.|    :.|..|:.....|||    |....:.||::
Zfish    67 TDDVDECRLQPNACQNGGKCSNTRNGYNCECVNGWSGLDCSENIDDCAYTPCFAGSTCIDR 127

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17111NP_651119.2 PAN_1 159..255 CDD:278453
PAN_AP_HGF 270..344 CDD:238532
si:ch73-281k2.5XP_009302182.1 EGF_CA 31..67 CDD:238011 18/62 (29%)
EGF_CA 69..106 CDD:238011 11/37 (30%)
EGF_CA 109..144 CDD:238011 6/20 (30%)
EGF_CA 186..224 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000109
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.