DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and rdh20

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_021332944.1 Gene:rdh20 ZFINID:ZDB-GENE-131127-122 Length:316 Species:Danio rerio

Alignment Length:297 Identity:84/298 (28%)
Similarity:143/298 (48%) Gaps:29/298 (10%)


  Fly    58 IVFLLLLPLVLLAV---FLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            ::||:.|.::||.|   .|:..|..:|.  .:.|.:.|::.|:||.|..|||...||..:.|.::
Zfish     1 MIFLMDLQVMLLDVLYFILRSCLRLVFR--PRTKPIDGELVLITGSGGALGRLFALEFTKHGAEV 63

  Fly   120 AVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELG-PVDILVNNASLMPM 183
            .:.|||.:...:|.:|: :.....|.||..||:...|:...|..|.:|:| .|..|||||.::..
Zfish    64 VLWDVNGEANEDTAKLV-RARGGQAHAYTVDVTKREEVYRTADLVREEVGRDVTYLVNNAGVVAG 127

  Fly   184 TSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYG 248
            ..........::..|::|..:...|.|.|||:|.::..||::.:.::.||........|.|:|:.
Zfish   128 ERLLDCPDYLLERTLKVNCHALFWTVKAFLPQMKDKNHGHIITIASVLGLFSTACVEDYCASKFA 192

  Fly   249 IEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAG----------IAKSYPGLPTPY 303
            ..||.|||..||...|.|.|:||:...|::          |.|          :|...|.|...|
Zfish   193 AVGFHESLAHELLTEDLDGVKTTLVCPYIV----------DTGMFEGCRIREEVALILPPLEPLY 247

  Fly   304 VAEKIVKGVLLNERMVYVPKIFALSVWLLRLLPTKWQ 340
            ..::.:..:|:::.:|.:|::..|......|||  |:
Zfish   248 CVQQAMNAILIDQPLVCIPRLTYLPFLARALLP--WE 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 74/262 (28%)
NADB_Rossmann 94..338 CDD:304358 72/255 (28%)
rdh20XP_021332944.1 17beta-HSDXI-like_SDR_c 38..282 CDD:187598 73/257 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.