DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and HSD17B11

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_057329.3 Gene:HSD17B11 HGNCID:22960 Length:300 Species:Homo sapiens

Alignment Length:289 Identity:89/290 (31%)
Similarity:144/290 (50%) Gaps:29/290 (10%)


  Fly    61 LLLLPLVL---LAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVV 122
            ||||||::   |..|:|     || :..:.|.|:|::.|:||.|.|:||....|.|:...||.:.
Human     8 LLLLPLLIVCSLESFVK-----LF-IPKRRKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLW 66

  Fly   123 DVNSKGCYETVELLSKIPRCVAK--AYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTS 185
            |:|..|..||.   :|.....||  .:..|.|:..::...|.||:.|:|.|.||||||.::..:.
Human    67 DINKHGLEETA---AKCKGLGAKVHTFVVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSD 128

  Fly   186 TPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIE 250
            ..:.:..:|:...::|:.::..|||.|||.|.....||:|.|.:.||.|.:|....|.::|:...
Human   129 LFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAV 193

  Fly   251 GFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS-----YPGLPTPYVAEKIVK 310
            ||.::|..||.......|:||..          .|...:.|..|:     .|.|....|..:::.
Human   194 GFHKTLTDELAALQITGVKTTCL----------CPNFVNTGFIKNPSTSLGPTLEPEEVVNRLMH 248

  Fly   311 GVLLNERMVYVPKIFALSVWLLRLLPTKW 339
            |:|..::|:::|...|....|.|:||.::
Human   249 GILTEQKMIFIPSSIAFLTTLERILPERF 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 76/257 (30%)
NADB_Rossmann 94..338 CDD:304358 75/251 (30%)
HSD17B11NP_057329.3 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.