DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and hsd17b11

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001011304.1 Gene:hsd17b11 XenbaseID:XB-GENE-1004190 Length:300 Species:Xenopus tropicalis

Alignment Length:304 Identity:92/305 (30%)
Similarity:150/305 (49%) Gaps:30/305 (10%)


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            |:::..||::....|..|:|     || :.||.|.|.|:|.|:||.|.|:|:............|
 Frog     5 LEIVWLLLVIVYSYLESFVK-----LF-IPLKRKSVKGEVVLITGAGHGIGKITAQIFGELESVL 63

  Fly   120 AVVDVNSKGCYETVELLSKIPRCVAKAYKN--DVSSPRELQLMAAKVEKELGPVDILVNNASLMP 182
            .:.|:|.:|..||.|   |..:..||.|..  |.|...|:...|.||::|:|.|.||:|||.::.
 Frog    64 VLWDINKQGVEETAE---KCRKGGAKVYTYVVDCSKREEINTAANKVKQEVGDVTILINNAGIIF 125

  Fly   183 MTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKY 247
            .....:|:..:|:.|.::|:.::..||:.|||.|:....||:|.|.:.||.|.:.....|.:||:
 Frog   126 CADVLTLQDQQIEKIFEVNILAHFWTTRAFLPSMLRNNHGHIVTVASSAGFVGVQFMVDYCSTKF 190

  Fly   248 GIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS-----YPGLPTPYVAEK 307
            ...|:.::|.|||.......::|:..          .|:..|.|..|:     .|.|....||:.
 Frog   191 AALGYHKALTAELLALGKSGIKTSCL----------CPVFVDTGFVKNPSLRLAPVLQPEEVAQT 245

  Fly   308 IVKGVLLNERMVYVPKIFALSVWLLRLLPTK----WQDYMLLRF 347
            :|.|:|:|::|:.||...:|...|...||.:    ..::..|:|
 Frog   246 LVDGILINKKMICVPSSVSLVPVLAFFLPERALNALNEFQNLKF 289

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 80/269 (30%)
NADB_Rossmann 94..338 CDD:304358 77/251 (31%)
hsd17b11NP_001011304.1 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 77/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.