DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and dhrs3b

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001006070.1 Gene:dhrs3b ZFINID:ZDB-GENE-041010-172 Length:302 Species:Danio rerio

Alignment Length:299 Identity:97/300 (32%)
Similarity:148/300 (49%) Gaps:38/300 (13%)


  Fly    54 NLKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCK 118
            :||.:..::|||:.:|...:|..:.:.  |..:.:|::|.|.|:||||.|:||.:..|.|.||.|
Zfish     2 DLKALGCVVLLPIQILYYTVKATVCWF--LPSRRRDLTGDVVLITGGGRGIGRHLAKEFAVRGAK 64

  Fly   119 LAVVDVNSKGCY-ETVELLSKI-PRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNA--- 178
            ..::...::.|. ||.|.::.: ..|  ..:..||::..|:...|..|.:::|.|.||||||   
Zfish    65 KLILWGRTEKCLKETCEEITLMGTEC--HYFVCDVANREEVYKQAKVVREKVGDVTILVNNAAVV 127

  Fly   179 ---SLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAG 240
               ||:.......|||..|:|:.|      ..|||.|||:|:..::||:|.||::..|.|:|||.
Zfish   128 HGKSLLDSDDDALLKSQHINTMGQ------FWTTKAFLPRMLELQNGHVVCVNSILSLSPIPGAI 186

  Fly   241 IYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDA----GIAKSYPGLPT 301
            .|..::.....|||||  .|.|.||..|..|..          ||..::.    |:...:|.|..
Zfish   187 DYCTSEASSLAFMESL--TLGLLDCPGVACTTV----------LPFHTNTEMFQGMRVRFPQLFP 239

  Fly   302 P----YVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLP 336
            |    .||::.|..|..|...||:|......|.|..:||
Zfish   240 PLKPEVVAQRTVDAVRTNTAFVYLPWTMNALVILKSMLP 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 88/263 (33%)
NADB_Rossmann 94..338 CDD:304358 87/260 (33%)
dhrs3bNP_001006070.1 FabG 48..278 CDD:223959 80/250 (32%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.