DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and sdr16c5b

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_999936.1 Gene:sdr16c5b ZFINID:ZDB-GENE-040426-2861 Length:306 Species:Danio rerio

Alignment Length:300 Identity:102/300 (34%)
Similarity:154/300 (51%) Gaps:33/300 (11%)


  Fly    47 ETTRAIFNLKVIVFLLLLPLVL-LAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICL 110
            ||.|.:|          |.||| |..|::     || :..:.|:|||::.|:||.|||:||.:.|
Zfish     6 ETLRVLF----------LSLVLGLEAFVR-----LF-IPPRRKNVSGELVLLTGAGSGIGRLMAL 54

  Fly   111 ELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILV 175
            |.||...:|.:.|:|..|..||..|:.:.....|..|..|.|...|:..:|.:|::|:|.|.||:
Zfish    55 EFARLDARLVLWDINEDGNKETARLIKEKYGARAHTYTCDCSDREEVYRVANQVKREVGDVTILI 119

  Fly   176 NNASLMP----MTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPL 236
            |||.::.    |.|..||    |:..:::|..::..|.|.|||.||....||||::.:.|||:.:
Zfish   120 NNAGIVTGKKFMDSPDSL----IEKSMEVNSLAHFWTYKAFLPAMIAGNHGHLVSIASSAGLIGV 180

  Fly   237 PGAGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAK---SYPG 298
            .|...|.|:|:...||.||:..||..:.||.|:||:...:.:.|.     :.|....|   ..|.
Zfish   181 NGLADYCASKFAAVGFAESMGLELLATGCDGVKTTIVCPFFINTG-----MFDGANTKWPRLMPI 240

  Fly   299 LPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLPTK 338
            |...|...|||..:...:..:|:|:...:.:.|..|||||
Zfish   241 LDPDYACRKIVDAIRREQVYLYMPRSIYIIIGLRNLLPTK 280

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 88/255 (35%)
NADB_Rossmann 94..338 CDD:304358 85/251 (34%)
sdr16c5bNP_999936.1 17beta-HSDXI-like_SDR_c 38..281 CDD:187598 86/252 (34%)
adh_short 39..233 CDD:278532 71/203 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.