DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and rdh10b

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_958488.1 Gene:rdh10b ZFINID:ZDB-GENE-030909-7 Length:336 Species:Danio rerio

Alignment Length:313 Identity:91/314 (29%)
Similarity:146/314 (46%) Gaps:51/314 (16%)


  Fly    55 LKVIVFLLLLPLVLLAV--FLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGC 117
            |.|:.|.::...||...  |::.          :||.|.|:|.::||.||||||...||.|||..
Zfish     7 LFVVTFKIIWSFVLAGAKWFIRP----------REKSVEGQVCVITGAGSGLGRLFALEFARRRA 61

  Fly   118 KLAVVDVNSKGCYETVELLSKIPRCVAKA-------------------YKNDVSSPRELQLMAAK 163
            .|.:.|:|.:...||.|:..:|.|.:..:                   |..|||....:.|.|.|
Zfish    62 TLVLWDINRQSNEETAEMAREIYRQLKPSTGSSDRVQELPLLQPKVYTYMCDVSKRESVYLTAEK 126

  Fly   164 VEKELGPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVN 228
            |..|:|.:|:|:|||.::..........:.|:..:.:|..::..|||.|||||:....||:|.|.
Zfish   127 VRSEVGDIDLLINNAGVVSGRHLLDCPDELIERTMMVNCHAHFWTTKAFLPKMLELNHGHIVTVA 191

  Fly   229 ALAGLVPLPGAGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAG-- 291
            :..||....|...|.|:|:|..||.|||..||:.:|.|.::.|:.          .|.|.|.|  
Zfish   192 SSLGLFTTAGVEDYCASKFGAIGFHESLSHELKAADKDGIKMTLV----------CPFLVDTGMF 246

  Fly   292 --------IAKSYPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLP 336
                    :|..:|.|...|..::.::.:|.::.|:..|::..:..::..:||
Zfish   247 EGCKIRKEMAPFFPPLKPEYCVKQAMRAILTDQPMICTPRVMYMVTFMKTVLP 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 82/276 (30%)
NADB_Rossmann 94..338 CDD:304358 81/273 (30%)
rdh10bNP_958488.1 DltE 36..309 CDD:223377 82/275 (30%)
17beta-HSDXI-like_SDR_c 38..302 CDD:187598 81/273 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.