DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and CG2064

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster

Alignment Length:193 Identity:56/194 (29%)
Similarity:88/194 (45%) Gaps:32/194 (16%)


  Fly    57 VIVFLLLLPLVL----LAVFLKHLLDYL----FALGLKEKDVSGKVALVTGGGSGLGREICLELA 113
            :.:..||.||::    :.|.:..|.:|:    |.   |:.|.:|||.:|||..:|:|:|..||:|
  Fly     3 IFIDCLLSPLIMWPATIGVGIYFLKEYMQGGKFT---KDTDETGKVFIVTGANTGIGKETALEIA 64

  Fly   114 RRG--CKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAK--------VEKEL 168
            |||  ..||..|:|.  |       .|..:.:.|...|.....|||.|.:..        .:||.
  Fly    65 RRGGTVYLACRDMNR--C-------EKARKDIIKETNNQNIFSRELDLSSLDSIRKFVDGFKKEQ 120

  Fly   169 GPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALA 231
            ..:.:|:|||.:|....|  |..|..:..|.:|...:.:.|...|..:.|.....:|.|::||
  Fly   121 PKLHVLINNAGVMRCPKT--LTKDGYELQLGVNHIGHFLLTNLLLDVLKNSAPSRIVVVSSLA 181

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 46/152 (30%)
NADB_Rossmann 94..338 CDD:304358 44/149 (30%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 47/154 (31%)
NADB_Rossmann 43..317 CDD:304358 46/151 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C15953145
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.