DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and CG15629

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_608859.1 Gene:CG15629 FlyBaseID:FBgn0031630 Length:325 Species:Drosophila melanogaster

Alignment Length:302 Identity:103/303 (34%)
Similarity:150/303 (50%) Gaps:18/303 (6%)


  Fly    46 DETTRAI--FNLKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREI 108
            |:..|||  |.|.::||.:.....:|......||...|.   |.||:||:|.|:||||.|:||.|
  Fly    11 DQPLRAIYQFLLDLLVFTIKSVYYVLESIYYSLLPQRFR---KLKDISGQVVLITGGGGGVGRLI 72

  Fly   109 CLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDI 173
            .|..||...::.:.|:|.:....||:||:|......|.|..|:|...::...|::|.:|:|||||
  Fly    73 ALNFARLQARIVIWDINQEAIKTTVDLLAKHGYDNCKGYVVDISDREQIYQRASQVTEEVGPVDI 137

  Fly   174 LVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPG 238
            |:|||.::.......|....|.....:|:.|:..|.|.|||.|:....||:|.|.::.|::...|
  Fly   138 LINNAGIVCCKPFWELHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYG 202

  Fly   239 AGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRT---SGDLPLLSDAGIAKSYPGLP 300
            ...|.||||...||.|||..:|:....|.::.::...|.:.|   ||..|        :..|.|.
  Fly   203 CSDYAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSGVRP--------RMMPMLE 259

  Fly   301 TPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLPTK--WQ 340
            ..|||::|...|..||....:|....|...|..|||.|  |:
  Fly   260 PQYVADRIENAVRCNEVWCVLPNSIRLLTPLKCLLPAKMCWE 301

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 88/256 (34%)
NADB_Rossmann 94..338 CDD:304358 84/247 (34%)
CG15629NP_608859.1 adh_short 57..252 CDD:278532 68/195 (35%)
17beta-HSDXI-like_SDR_c 58..298 CDD:187598 85/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C134632816
eggNOG 1 0.900 E2759_KOG1201
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 96 1.000 Inparanoid score I1462
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24322
RoundUp 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.