DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and HSD11B1

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 / 3290 HGNCID:5208 Length:292 Species:Homo sapiens


Alignment Length:308 Identity:86/308 - (27%)
Similarity:149/308 - (48%) Gaps:47/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LLPLVLLAVFLKHLLDYLFALG--LKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVN 125
            |||  :|.:|:.:   |.::..  .:.:.:.||..:|||...|:|||:...||:.|..: ||...
Human     8 LLP--ILGLFMAY---YYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHV-VVTAR 66

  Fly   126 SKGCYETVELLSK-IPRCV----AKAY-----KNDVSSPRELQLMAAKVEKELGPVDILVNNASL 180
            ||      |.|.| :..|:    |.|:     ..|::...:....|.|:   :|.:|:|:.|   
Human    67 SK------ETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKL---MGGLDMLILN--- 119

  Fly   181 MPMTSTP-SLKSDEIDTI---LQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGI 241
             .:|:|. :|..|:|..:   :::|..||::.|...|| |:.:.:|.:|.|::|||.|..|....
Human   120 -HITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGSIVVVSSLAGKVAYPMVAA 182

  Fly   242 YTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPYVAE 306
            |:|:|:.::||..|:|.|..:|..: |..|:....|:.|...:..:|  ||. .....|....|.
Human   183 YSASKFALDGFFSSIRKEYSVSRVN-VSITLCVLGLIDTETAMKAVS--GIV-HMQAAPKEECAL 243

  Fly   307 KIVKGVLLNERMVYVPKIFALSVW---LLRLLPTKWQDYMLLRFYHFD 351
            :|:||..|.:..||    :..|:|   |:|....|..:::....|:.|
Human   244 EIIKGGALRQEEVY----YDSSLWTTLLIRNPCRKILEFLYSTSYNMD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 78/274 (28%)
NADB_Rossmann 94..338 CDD:304358 75/260 (29%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 78/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3540
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.