DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and HSD11B1

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001193670.1 Gene:HSD11B1 HGNCID:5208 Length:292 Species:Homo sapiens

Alignment Length:308 Identity:86/309 (28%)
Similarity:149/309 (48%) Gaps:47/309 (15%)


  Fly    63 LLPLVLLAVFLKHLLDYLFALG--LKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVN 125
            |||  :|.:|:.:   |.::..  .:.:.:.||..:|||...|:|||:...||:.|..: ||...
Human     8 LLP--ILGLFMAY---YYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHV-VVTAR 66

  Fly   126 SKGCYETVELLSK-IPRCV----AKAY-----KNDVSSPRELQLMAAKVEKELGPVDILVNNASL 180
            ||      |.|.| :..|:    |.|:     ..|::...:....|.|:   :|.:|:|:.|   
Human    67 SK------ETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKL---MGGLDMLILN--- 119

  Fly   181 MPMTSTP-SLKSDEIDTI---LQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGI 241
             .:|:|. :|..|:|..:   :::|..||::.|...|| |:.:.:|.:|.|::|||.|..|....
Human   120 -HITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALP-MLKQSNGSIVVVSSLAGKVAYPMVAA 182

  Fly   242 YTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPYVAE 306
            |:|:|:.::||..|:|.|..:|..: |..|:....|:.|...:..:|  ||. .....|....|.
Human   183 YSASKFALDGFFSSIRKEYSVSRVN-VSITLCVLGLIDTETAMKAVS--GIV-HMQAAPKEECAL 243

  Fly   307 KIVKGVLLNERMVYVPKIFALSVW---LLRLLPTKWQDYMLLRFYHFD 351
            :|:||..|.:..||    :..|:|   |:|....|..:::....|:.|
Human   244 EIIKGGALRQEEVY----YDSSLWTTLLIRNPCRKILEFLYSTSYNMD 287

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 79/275 (29%)
NADB_Rossmann 94..338 CDD:304358 75/261 (29%)
HSD11B1NP_001193670.1 11beta-HSD1_like_SDR_c 32..279 CDD:187593 78/270 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S3540
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.