DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and spidey

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_572420.1 Gene:spidey FlyBaseID:FBgn0029975 Length:321 Species:Drosophila melanogaster

Alignment Length:324 Identity:84/325 (26%)
Similarity:151/325 (46%) Gaps:57/325 (18%)


  Fly    54 NLKVIVFL--LLLPLVLLAVFLKHLLDYLFA--LGLK----EKDVS--GKVALVTGGGSGLGREI 108
            |.:|:..|  |.:.:|...||.| :|.:::|  :|.|    ..|:|  |:.|:|||...|:|:..
  Fly     5 NSQVLSLLGGLAIGIVGFQVFRK-VLPWIYANVVGPKVFGSSVDLSKMGEWAVVTGSTDGIGKAY 68

  Fly   109 CLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQL-------MAAKV-E 165
            ..||||||.||.::.       .::|.|:.:.:.:...|..:|   |.:.:       :..|: |
  Fly    69 AKELARRGLKLVLIS-------RSLEKLNVVAKEIGDKYGVEV---RVIDVDFTGGDEIYDKIRE 123

  Fly   166 KELG-PVDILVNNASLM---PMTSTPSLKSDE--IDTILQLNLGSYIMTTKEFLPKMINRKSGHL 224
            |..| .|.:||||..:.   |.......|:|.  :..|:..|:.|....|..|||.||:::.|.:
  Fly   124 KTTGLNVGVLVNNVGISYGHPEYFLDCYKADPPFLRNIVAANIHSVTHMTALFLPGMISQRRGVI 188

  Fly   225 VAVNALAGLVPLPGAGIYTATKYGIEGFMESLRAE-------LRLSDCDYVRTTVANAYLMRTSG 282
            :.|::.||::|.|...:|::||..:..|.:.|:.|       ::.....:|.|.::.  :.:.|.
  Fly   189 INVSSTAGVIPNPLLSVYSSTKAFVNKFSDDLQTEYKEHGILIQSVQPGFVATNMSK--IRKASV 251

  Fly   283 DLP--------LLSDAGIAKSYPGLPTPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRLLPTK 338
            ..|        .||..|||....|    |:...:::.|:.....|:..: ||.::.:..:|.|:
  Fly   252 FAPSPETYVRSALSTLGIATQTAG----YLPHALLQLVIHFTEAVFGEQ-FARNIVMKNILGTR 310

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 71/280 (25%)
NADB_Rossmann 94..338 CDD:304358 69/273 (25%)
spideyNP_572420.1 PLN02780 8..321 CDD:166421 83/322 (26%)
17beta-HSD1_like_SDR_c 52..288 CDD:187614 65/252 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C15949425
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.