DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and CG3603

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster

Alignment Length:169 Identity:57/170 (34%)
Similarity:87/170 (51%) Gaps:8/170 (5%)


  Fly    90 VSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSP 154
            ::||||||||.|||:||..|..|||.|.|:..||.|.|...|||:.|....   :.|.:.||||.
  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETVQELGSER---SAALEVDVSSA 67

  Fly   155 RELQLMAAKVEKEL--GPVDILVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMI 217
            :.:|...|:..|:.  .|. |:||:|.:........:...:.|.:..:||....:.|:.:...||
  Fly    68 QSVQFSVAEALKKFQQAPT-IVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAKAMI 131

  Fly   218 NRK--SGHLVAVNALAGLVPLPGAGIYTATKYGIEGFME 254
            .:|  :|.:|.::::...:...|...|.|||.|:..|.|
  Fly   132 EQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTE 170

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 57/169 (34%)
NADB_Rossmann 94..338 CDD:304358 55/166 (33%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 57/170 (34%)
BKR_SDR_c 9..248 CDD:187594 56/167 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C15949002
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.