DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and Hsd17b13

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001009684.1 Gene:Hsd17b13 RGDID:1359553 Length:300 Species:Rattus norvegicus

Alignment Length:289 Identity:83/290 (29%)
Similarity:147/290 (51%) Gaps:18/290 (6%)


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            :.:|:.||||..:::..:|:.|:.  |.:..:.|.|:|:..|:||.|.|:||....|.|::..:|
  Rat     1 MNLILELLLLVGIIIYSYLESLVK--FFIPQRRKSVAGQTVLITGAGHGIGRLTAYEFAKQKSRL 63

  Fly   120 AVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMT 184
            .:.|::..|..||.....|: ..|...:..|.|:..|:.....:|:||:|.::|:||||..:...
  Rat    64 VLWDISKHGVEETAAKCRKL-GAVVHVFVVDCSNRAEIYKSVDQVKKEVGDIEIVVNNAGAIYPA 127

  Fly   185 STPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGI 249
            ...|.|.:||....::|:..:....|..||.|:.|.|||:|.|.::.|...:|....|.::|:..
  Rat   128 DLLSTKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHRVIPYLIPYCSSKFAA 192

  Fly   250 EGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS-----YPGLPTPYVAEKIV 309
            .||..:|.|||     |.:..|.     ::||...|:..:.|..|:     :|.|....||..::
  Rat   193 VGFHRALTAEL-----DTLGKTG-----IKTSCLCPVFVNTGFTKNPSTRLWPVLEPDEVARSLI 247

  Fly   310 KGVLLNERMVYVPKIFALSVWLLRLLPTK 338
            .|:|.|::|::||....:|:.:....|.:
  Rat   248 DGILTNKKMIFVPSYINISLIVEMFFPER 276

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 73/254 (29%)
NADB_Rossmann 94..338 CDD:304358 72/249 (29%)
Hsd17b13NP_001009684.1 adh_short 37..228 CDD:278532 60/202 (30%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 72/251 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.