DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and Vps13d

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001263431.1 Gene:Vps13d MGIID:2448530 Length:4390 Species:Mus musculus

Alignment Length:377 Identity:74/378 (20%)
Similarity:147/378 (39%) Gaps:90/378 (24%)


  Fly    11 TRTTTAVPAGAVT-----VTGPTASATPTATQAAAQAHRNDETTR-------AIFNLKVIVFLLL 63
            ||.:...|:..:|     :..|:.|:  :|||.:.|...:..:|:       .:.||:  |||:.
Mouse  2345 TRYSGQKPSHGMTNVFNCIFQPSKSS--SATQGSIQIELHFRSTKDSSCFTVVLNNLR--VFLIF 2405

  Fly    64 LPLVLLAVFLKHLLDYLFALGLKEKDVSG-----------------KVALVTGGGS-GLGREICL 110
            ..|:|:..||....|      :|:::|:.                 |..:||...| .:..|..|
Mouse  2406 DWLLLVHDFLHTPSD------IKKQNVTPARHRNASSESAVVPKTVKSGVVTKRSSLPVSNERHL 2464

  Fly   111 ELARRGCKLAVVDVNSKGCYET-------VELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKE- 167
            |:.........|.|....|::|       ..:|:..||.|.:.:...:..   :::.:.::..| 
Mouse  2465 EVKVNVTGTEFVVVEDVSCFDTNAIILKGTTVLTYKPRFVDRPFSGSLFG---IEVFSCRLGNEQ 2526

  Fly   168 ------LGPVDI---LVNNASLMPMTS-TPSLKSDEIDTILQLNLG------SY-----IMTTKE 211
                  :.||.|   ||.|:|....:. ..:..|::...||::.|.      ||     .:...:
Mouse  2527 DTALSIVDPVQIQVELVGNSSYQNSSGLMDAFNSEDFPPILEIQLQALDIRLSYNDVQLFLAIAK 2591

  Fly   212 FLPKMINRKSGHLVAVNALAGLVPLPGAG-----IYTATKYGIEGFMESLRAELR-----LSDCD 266
            .:|:..:..:....|:...:....||||.     :...:::.::..:|...|.|:     :.||.
Mouse  2592 SIPEQASAAAPDSSALEVDSISCSLPGASRIGEDVREGSRHTLDPVLELQLARLQELGFSMDDCR 2656

  Fly   267 YV------RTTVANAYLMRTSGDLPLLS-DAGIAKSYPG-LPTPYVAEKIVK 310
            ..      :...|.::|.:.:..|..|| .:..::..|| :|.|.::...||
Mouse  2657 KALLVCQGQLKKAASWLFKNAEPLKSLSLVSSSSRDNPGTMPAPRISGVEVK 2708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 51/286 (18%)
NADB_Rossmann 94..338 CDD:304358 50/266 (19%)
Vps13dNP_001263431.1 Chorein_N 3..112 CDD:289396
VPS13 140..357 CDD:293513
VPS13_mid_rpt 615..895 CDD:293515
UBA_VP13D 2642..2677 CDD:270491 6/35 (17%)
SHR-BD 3277..3560 CDD:284143
VPS13_C 3986..4131 CDD:293514
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D504609at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.