DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and Dhrs3

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_035433.1 Gene:Dhrs3 MGIID:1315215 Length:302 Species:Mus musculus

Alignment Length:292 Identity:92/293 (31%)
Similarity:145/293 (49%) Gaps:38/293 (13%)


  Fly    61 LLLLPLVLLAVFLKHLLDYLFALGL----KEKDVSGKVALVTGGGSGLGREICLELARRGCKLAV 121
            |::.||.::.:..|      .|:|:    |.:|:|.:..|:||||.|:||.:..|.|.||.:..|
Mouse     9 LVVFPLQMIYLVTK------AAVGMVLPPKLRDLSRESVLITGGGRGIGRHLAREFAERGARKIV 67

  Fly   122 VDVNSKGCY-ETVELLSKI-PRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNA------ 178
            :...::.|. ||.|.:.:: ..|  ..:..||.:..|:..||..|.:::|.:.||||||      
Mouse    68 LWGRTEKCLKETTEEIRQMGTEC--HYFICDVGNREEVYQMAKAVREKVGDITILVNNAAVVHGK 130

  Fly   179 SLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYT 243
            |||.......|||..::|     ||.: .|||.|||:|:..::||:|.:|::..|..:|||..|.
Mouse   131 SLMDSDDDALLKSQHVNT-----LGQF-WTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYC 189

  Fly   244 ATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTPY----V 304
            .:|.....|||||  .|.|.||..|..|....:  .||.::    ..|:...:|.|..|.    |
Mouse   190 TSKASAFAFMESL--TLGLLDCPGVSATTVLPF--HTSTEM----FQGMRVRFPNLFPPLKPETV 246

  Fly   305 AEKIVKGVLLNERMVYVPKIFALSVWLLRLLP 336
            |.:.|..|..|:.::.:|....:.:.|..:||
Mouse   247 ARRTVDAVQQNQALLLLPWTMNILIILKSILP 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 84/259 (32%)
NADB_Rossmann 94..338 CDD:304358 83/256 (32%)
Dhrs3NP_035433.1 PRK09072 35..288 CDD:236372 85/261 (33%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.