DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and dhs-29

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_509294.1 Gene:dhs-29 WormBaseID:WBGene00000992 Length:427 Species:Caenorhabditis elegans

Alignment Length:322 Identity:88/323 (27%)
Similarity:162/323 (50%) Gaps:34/323 (11%)


  Fly    64 LPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKG 128
            |.:.|..:|:...:|....|.|::|.|.|:..::|||||||||.:.|:.|:|..|:|::|||.:|
 Worm    13 LGVALRILFIDIPMDIHRFLNLRQKSVQGQTVIITGGGSGLGRAMALDFAKRKAKVAIIDVNKEG 77

  Fly   129 CYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSDE 193
            ..|||:.::.... :||.:..|:|....::..|.::|...|.|:|::.||:::..||...:..:.
 Worm    78 GLETVKTIAAEGN-MAKFWYCDISDVDNMKKTAKEIEDTFGDVNIVICNAAILSFTSFMEISDEL 141

  Fly   194 IDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLRA 258
            :...|.:|:...|.|.:.|||||..:..||:|.|.::||.........|..:|:.:.|.||||:.
 Worm   142 LRKCLDVNIFGTINTIRAFLPKMETKNDGHIVCVCSIAGWSGETMGLSYCTSKFAVRGAMESLQM 206

  Fly   259 ELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS---YPGLPTPYVAEKIVKGVLLNERMVY 320
            |||....:.::||....|..||    |::.:..:..:   :|.:.....::::|..:|..:...:
 Worm   207 ELRDRGLEGIKTTTLYPYFART----PMILENNMRPTCTWFPFMSIRSCSKRMVDSILKEKVHAF 267

  Fly   321 VPKIFAL--------SVWLLRLLPTKWQDYMLLRFYHFD--------------VRSSHLFYW 360
            ||....|        |:.:.|.|    ::|:.:::...|              .::..||:|
 Worm   268 VPSYITLIPFVKNFCSLQVCRSL----RNYLGVKYSASDPSFCKLTLIEMSDYYKTPQLFWW 325

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 76/269 (28%)
NADB_Rossmann 94..338 CDD:304358 74/255 (29%)
dhs-29NP_509294.1 adh_short 42..230 CDD:278532 65/193 (34%)
NADB_Rossmann 43..281 CDD:304358 71/243 (29%)
DUF4499 322..416 CDD:291595 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.970

Return to query results.
Submit another query.