DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and dhs-4

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_492563.1 Gene:dhs-4 WormBaseID:WBGene00000968 Length:305 Species:Caenorhabditis elegans

Alignment Length:300 Identity:88/300 (29%)
Similarity:157/300 (52%) Gaps:17/300 (6%)


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            |::::.|..|.:..|...:|:.|.|..   |.:||:..|..|:||.|:|||:.:..:.|.||..|
 Worm     6 LEIVILLFNLLIQNLISLIKYALPYSL---LPKKDLYRKKVLITGAGNGLGKLLAQKFAARGATL 67

  Fly   120 AVVDVNSKGCYETVELLSKI--PRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMP 182
            .:.|:|.:   ...||.::|  .:..|.:|:.::..|.::..:..:|..::|.||||||||.:..
 Worm    68 ILWDINLQ---SVDELKNEIRGNQGEAHSYEVNLCDPGKIAQVGQQVINDIGKVDILVNNAGIAT 129

  Fly   183 MTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKY 247
            .........:||:....:|:.::..|.::|||.|:...:||:|.:.:.||.:...|...|::||:
 Worm   130 AKMILDSSENEINRSFDVNVKAHFYTVQQFLPAMLKDNNGHIVTIASAAGKMGSSGLADYSSTKH 194

  Fly   248 GIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPG----LPTPYVAEKI 308
            ...||.:||.||:..|:.:.|:||:...|.:.||    :....|.|..:|.    |.|.||.:||
 Worm   195 AAVGFHDSLVAEIMESEKNGVKTTLVCPYYVHTS----MFDATGAATRFPWIFPILDTDYVVQKI 255

  Fly   309 VKGVLLNERMVYVPKIFALSVWLLRLLPTKWQDYMLLRFY 348
            .:.:...:..:..|:.|.|....:::||.|.| .|:.:|:
 Worm   256 FEAIETEQEFLVTPRAFYLVFAGIQILPYKAQ-AMVAQFF 294

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 78/264 (30%)
NADB_Rossmann 94..338 CDD:304358 73/250 (29%)
dhs-4NP_492563.1 adh_short 41..235 CDD:278532 61/201 (30%)
17beta-HSDXI-like_SDR_c 43..286 CDD:187598 74/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.