DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG17121 and LOC100489103

Sequence 1:NP_651114.1 Gene:CG17121 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:XP_002933209.2 Gene:LOC100489103 ID: Length:316 Species:Xenopus tropicalis

Alignment Length:290 Identity:84/291 (29%)
Similarity:142/291 (49%) Gaps:25/291 (9%)


  Fly    75 HLL----DYLFALGLK------EKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSKGC 129
            |||    .::...|:|      ||.:...:.|:||.|.|:|:...||.|::|..|.:.|.:.: |
 Frog    18 HLLWDVCRHILLSGVKWVVKPEEKSIMDDICLITGSGGGIGKHFALEFAKKGAILVLWDSDPE-C 81

  Fly   130 YETVELLSKIPRCVAKA--YKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSD 192
            .|  |...::.|..|:|  |..|....:::..:|.:|.:|:|.|.||:|:.|.....|....:.:
 Frog    82 NE--ETAKEVRRLGARAFTYTCDTGDRQQVYQVAERVRREVGDVTILLNHPSTGTGKSLLHCQDE 144

  Fly   193 EIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLR 257
            |::..|:.|..:...|.|.|||:|.....||::.|.:..||........|....:...||.|:|.
 Frog   145 ELENALRTNCLANFWTVKAFLPRMNQMNHGHVINVASYLGLFATANMEDYCTAHFATVGFHEALS 209

  Fly   258 AELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPGLPTP----YVAEKIVKGVLLNERM 318
            .||:......|:||:...||    .|:.:.|...|.|....|.||    |.|.:.:.|:|.::.|
 Frog   210 HELKARRISGVKTTLLCPYL----ADIEMYSSFKIRKDLATLFTPLTSEYFARRAINGILTDQPM 270

  Fly   319 VYVPKIFALSVWLLRLLPTKWQD--YMLLR 346
            :.:||:..|:.:|.::||.:.|:  :.|:|
 Frog   271 ICMPKLLYLAAFLKQVLPWEVQELCHSLIR 300

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 77/265 (29%)
NADB_Rossmann 94..338 CDD:304358 74/250 (30%)
LOC100489103XP_002933209.2 17beta-HSDXI-like_SDR_c 47..291 CDD:187598 74/251 (29%)
DltE 48..302 CDD:223377 77/261 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1373099at2759
OrthoFinder 1 1.000 FOG0000166
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.