DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and MYOT

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_006781.1 Gene:MYOT HGNCID:12399 Length:498 Species:Homo sapiens

Alignment Length:397 Identity:93/398 (23%)
Similarity:141/398 (35%) Gaps:106/398 (27%)


  Fly    61 HAGS--------------GGFAVEAAISNRGSNSRSM-----SNVQQSAV-----AASTLTAT-- 99
            ||||              ..|......|....||..:     ||.|||:.     |..:.||.  
Human    76 HAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNYQQSSAGQPINAKPSQTANAK 140

  Fly   100 -LPRFLSRGH----TYRAVVGD-TLVLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERV--RL 156
             :||  :..|    :..|::.| ...|.|:...|.|              .|..:|.:|::  ||
Human   141 PIPR--TPDHEIQGSKEALIQDLERKLKCKDTLLHN--------------GNQRLTYEEKMARRL 189

  Fly   157 IDGYNLEISDLEPQDAGDYVCQISDKIN----RDQVHTVEI-------------------LVPPS 198
            :...|.........|:|   .|.|.:.|    |.||.|.::                   ..||.
Human   190 LGPQNAAAVFQAQDDSG---AQDSQQHNSEHARLQVPTSQVRSRSTSRGDVNDQDAIQEKFYPPR 251

  Fly   199 VRAIPTSGQLQARKGGPITLECKGSGNPVPSIYW------TKKSGANKSTARIGDGPILTLEKLE 257
            ...:|.:  :...:|....::.|.||.|.|.:.|      .:....:|..........|..|.:.
Human   252 FIQVPEN--MSIDEGRFCRMDFKVSGLPAPDVSWYLNGRTVQSDDLHKMIVSEKGLHSLIFEVVR 314

  Fly   258 RQQAGVYQCTADNGVGDPVTVDMRLDVL-----------YPPDIQVEKSWIHSGEGFEAKLVCIV 311
            ...||.|.|.|.|..|: .|..::||||           |.|  |.:|..    ||...||.|.:
Human   315 ASDAGAYACVAKNRAGE-ATFTVQLDVLAKEHKRAPMFIYKP--QSKKVL----EGDSVKLECQI 372

  Fly   312 FADPVATVSWYQNSFPIQ-STDR-RIMATRANRHMLTIRHIQQEDFGNYSCVADNSLG--RSRKY 372
            .|.|...:.|.:|:..:| :||| .:......|..|.|:.:.::|.|.|:..|.|..|  .....
Human   373 SAIPPPKLFWKRNNEMVQFNTDRISLYQDNTGRVTLLIKDVNKKDAGWYTVSAVNEAGVTTCNTR 437

  Fly   373 MELSGRP 379
            ::::.||
Human   438 LDVTARP 444

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 21/93 (23%)
IG_like 109..195 CDD:214653 21/112 (19%)
Ig 118..191 CDD:143165 19/79 (24%)
IG_like 205..274 CDD:214653 17/75 (23%)
IGc2 213..273 CDD:197706 16/66 (24%)
IGc2 301..367 CDD:197706 21/68 (31%)
FN3 392..486 CDD:238020
MYOTNP_006781.1 Necessary for interaction with ACTN1 79..150 16/73 (22%)
Necessary for interaction with ACTA1. {ECO:0000269|PubMed:12499399} 215..498 57/240 (24%)
Necessary for interaction with FLNC 215..493 57/240 (24%)
Ig 249..333 CDD:299845 20/87 (23%)
I-set 250..340 CDD:254352 22/93 (24%)
I-set 349..440 CDD:254352 26/97 (27%)
Ig_Myotilin_C 366..440 CDD:143300 20/74 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45080
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.