DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and DIP-epsilon

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001137799.1 Gene:DIP-epsilon FlyBaseID:FBgn0259714 Length:467 Species:Drosophila melanogaster

Alignment Length:351 Identity:96/352 (27%)
Similarity:159/352 (45%) Gaps:56/352 (16%)


  Fly    50 IVISLGWLLHAHAGSGGFAVEAAISNRGSNSRSMSNVQQSAVAASTLTATL---PRFLSRGHTYR 111
            :.:.||.|:         |...|:|....:..:..|     |..|||...:   |.|........
  Fly    12 LYVGLGCLI---------ASSVALSTDTGSEGNAGN-----VGGSTLNNVISEDPEFTDVIENIT 62

  Fly   112 AVVGDTLVLPCQVENLGNFVLLWR--RGTNVLTASNIMVTRDERVRLI-DGYN------LEISDL 167
            ...|..:.|.|.|:|||::.:.|.  ..:.:||..|.::||:.|:.:. |.::      |.|:::
  Fly    63 VPAGRNVKLACSVKNLGSYKVAWMHFEQSAILTVHNHVITRNPRISVTHDKHDKHRTWFLHINNV 127

  Fly   168 EPQDAGDYVCQISDKINRDQVHTVEILVPPSVRAIPTSGQLQARKGGPITLECKGSGNPVPSIYW 232
            :.:|.|.|:|||:....:.|...|:::|||::....||..:..|:|..:||.||..|:|.|:|.|
  Fly   128 QEEDRGRYMCQINTVTAKTQYGFVKVVVPPNIDDALTSSDIIVREGDNVTLRCKAKGSPEPTIKW 192

  Fly   233 TKKSGANK----STARIGD--GPILTLEKLERQQAGVYQCTADNGVGDPVTVDMRLDVLYPPDIQ 291
             |:...||    .|..:.|  ...|.||::.|...|.|.|.|.|||...|:..:::.|.:.|.:.
  Fly   193 -KRDDGNKIVINKTLEVHDLETDSLELERISRLHMGAYLCIASNGVPPSVSKRIKVSVDFSPMVW 256

  Fly   292 VEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQSTDRRIMATRANRH------------- 343
            :....:....||...|.|.:.|:|.:...|      .:..|:  |.|.::::             
  Fly   257 IPHQLVGIPIGFNITLECFIEANPTSLNYW------TRENDQ--MITESSKYKTETIPGHPSYKA 313

  Fly   344 --MLTIRHIQQEDFGNYSCVADNSLG 367
              .|||.::|..|:|||.|||.|..|
  Fly   314 TMRLTITNVQSSDYGNYKCVAKNPRG 339

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 13/64 (20%)
IG_like 109..195 CDD:214653 25/95 (26%)
Ig 118..191 CDD:143165 23/82 (28%)
IG_like 205..274 CDD:214653 28/75 (37%)
IGc2 213..273 CDD:197706 26/66 (39%)
IGc2 301..367 CDD:197706 22/81 (27%)
FN3 392..486 CDD:238020
DIP-epsilonNP_001137799.1 IG_like 59..155 CDD:214653 25/96 (26%)
Ig 69..139 CDD:143165 21/70 (30%)
IG_like 165..249 CDD:214653 29/85 (34%)
IGc2 172..237 CDD:197706 25/66 (38%)
IG_like 267..348 CDD:214653 23/82 (28%)
Ig 270..339 CDD:299845 20/77 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80497655
eggNOG 1 0.900 E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.