DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Palld

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001280701.1 Gene:Palld MGIID:1919583 Length:1408 Species:Mus musculus

Alignment Length:491 Identity:108/492 (22%)
Similarity:161/492 (33%) Gaps:160/492 (33%)


  Fly    63 GSGGFAVEAAISNR--GSNSRSMSNVQQSAVAASTLTATLPRFLSRGHTYRAVVGDTL------- 118
            |......|..::.|  |::|.::.|:|:....|:...|..|         ||.||..|       
Mouse   930 GQPRLTYEERMARRLLGADSANVFNIQEPEETAANQDAGAP---------RASVGGPLDGQKEYK 985

  Fly   119 VLPCQVENLGNFVLLWRRGTNVLTASNIMVTRDERVRLID--GYNLEISDLEPQDAGDYVCQISD 181
            |..|:                              .|||.  .|.||.|.::  ::||.|     
Mouse   986 VSSCE------------------------------QRLISEIEYRLERSPVD--ESGDEV----- 1013

  Fly   182 KINRDQVHTVEILVPPSVRAIPTSGQLQARK---GGPITLECKGSGNPVPSIYWTK-------KS 236
               :|....||....|....     :|:..|   |.|:|..|:.:|||.|.|||.|       ||
Mouse  1014 ---QDPDVPVENATAPFFEM-----KLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKS 1070

  Fly   237 -------------GANKSTARIGDGPILTLEKLERQQAGVYQCTA-------------------- 268
                         ..:.:.:.:.|....|:.....|  |...||.                    
Mouse  1071 DHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQ--GRVSCTGRLMVQAVNQRGRSPRSPSGH 1133

  Fly   269 -----------DNG-VGDPVTVD-MRLDVLYPP-DIQVEKSWIHSGEGFEAKLVCIVFADPVATV 319
                       |:| ..:|:... .|...|..| |:.|:       ||...::.|.|...|...:
Mouse  1134 PHARRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQ-------EGKLCRMDCKVSGLPTPDL 1191

  Fly   320 SWYQNSFPIQSTDRRIMATRANR-HMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAE 383
            ||..:..||:......|..|.|. |.|.|..:...|.|.|:|:|.|..|::...:||.  ..|.|
Mouse  1192 SWQLDGKPIRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFNLELV--VAAKE 1254

  Fly   384 FYSPKWGRSP---DSYNLTWKIDSYPPLEEVRLLYRRVQMNETYQQPGRWHDFILTPEHRPASEP 445
            .:     ::|   :....|...|.||...|.|:  ..|...:.:     |         :..:|.
Mouse  1255 AH-----KAPVFMEKLQNTGVADGYPVRLECRV--SGVPPPQIF-----W---------KKENES 1298

  Fly   446 LTHIMSYTIKNLHPGGYYEAIVQ--AKNRYGWNEVS 479
            |||.......:....||...::|  .|...||..||
Mouse  1299 LTHSTERVSMHQDNHGYICLLIQGATKEDAGWYTVS 1334

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 17/70 (24%)
IG_like 109..195 CDD:214653 20/95 (21%)
Ig 118..191 CDD:143165 14/82 (17%)
IG_like 205..274 CDD:214653 24/124 (19%)
IGc2 213..273 CDD:197706 22/112 (20%)
IGc2 301..367 CDD:197706 21/67 (31%)
FN3 392..486 CDD:238020 21/94 (22%)
PalldNP_001280701.1 I-set 278..368 CDD:254352
Ig 295..365 CDD:143165
I-set 448..545 CDD:254352
Ig 465..542 CDD:143165
I-set 1026..1117 CDD:254352 23/98 (23%)
Ig 1043..1112 CDD:143165 17/71 (24%)
I-set 1160..1250 CDD:254352 28/99 (28%)
Ig 1178..1243 CDD:143165 20/65 (31%)
I-set 1259..1350 CDD:254352 21/93 (23%)
Ig_Palladin_C 1276..1350 CDD:143301 16/76 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45080
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.