DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: klg and Negr1

Sequence 1:NP_524454.2 Gene:klg FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_067714.1 Gene:Negr1 RGDID:708416 Length:348 Species:Rattus norvegicus

Alignment Length:314 Identity:93/315 (30%)
Similarity:147/315 (47%) Gaps:23/315 (7%)


  Fly    84 SNVQQSAVAASTLTATLPRFLSRGHTYRAV------VGDTLVLPCQVENLGNFVLLWRRGTNVLT 142
            ||...:||..| |.:.||...|....:.||      .|||.||.|.:|: |.....|...::::.
  Rat    11 SNQWLAAVLLS-LCSCLPAGQSVDFPWAAVDNMLVRKGDTAVLRCYLED-GASKGAWLNRSSIIF 73

  Fly   143 ASNIMVTRDERVRLID----GYNLEISDLEPQDAGDYVCQISDK--INRDQVHTVEILVPPSVRA 201
            |.....:.|.||.:..    .|:|:|.:::..|.|.|.|.:..:  ....||| :.:.|||.:..
  Rat    74 AGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVH-LTVQVPPKIYD 137

  Fly   202 IPTSGQLQARKGGPITLECKGSGNPVPSIYWTKKSGANKSTARIGDGPILTLEKLERQQAGVYQC 266
            |  |..:...:|..:||.|..:|.|.|:|.|...|.:.|.   ..:|..|.:..:.|.|||.|:|
  Rat   138 I--SNDMTINEGTNVTLTCLATGKPEPAISWRHISPSAKP---FENGQYLDIYGITRDQAGEYEC 197

  Fly   267 TADNGVGDPVTVDMRLDVLYPPDIQVEKSWIHSGEGFEAKLVCIVFADPVATVSWYQNSFPIQST 331
            :|:|.|..|....:|:.|.:.|.||..||...: .|....:.|.....|.....||:....:.:.
  Rat   198 SAENDVSFPDVKKVRVVVNFAPTIQEIKSGTVT-PGRSGLIRCEGAGVPPPAFEWYKGEKRLFNG 261

  Fly   332 DRRIMATR-ANRHMLTIRHIQQEDFGNYSCVADNSLGRSRKYMELSGRPGAAEF 384
            .:.|:... :.|.:||:.::.||.||||:|||.|.||.:...:.|: .|..|::
  Rat   262 QQGIIIQNFSTRSILTVTNVTQEHFGNYTCVAANKLGTTNASLPLN-PPSTAQY 314

Known Domains:


GeneSequenceDomainRegion External IDIdentity
klgNP_524454.2 DUF1370 63..>124 CDD:284518 17/46 (37%)
IG_like 109..195 CDD:214653 25/98 (26%)
Ig 118..191 CDD:143165 20/79 (25%)
IG_like 205..274 CDD:214653 23/69 (33%)
IGc2 213..273 CDD:197706 22/60 (37%)
IGc2 301..367 CDD:197706 20/67 (30%)
FN3 392..486 CDD:238020
Negr1NP_067714.1 Ig 38..129 CDD:299845 25/93 (27%)
IG_like 41..129 CDD:214653 23/90 (26%)
IG_like 139..215 CDD:214653 25/79 (32%)
IGc2 146..204 CDD:197706 22/61 (36%)
IG_like 225..306 CDD:214653 23/82 (28%)
Ig 237..303 CDD:143165 20/66 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C80491060
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000159
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.